PRGDB00074295 (Ppe.5558)

From PRG Wiki
Jump to: navigation, search
Ppe.5558
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 51919091 (AJ825569)
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Prunus persica

Comment?

AJ825569 S4 Prunus persica cDNA clone S45C19, mRNA sequence

DNA Sequence

CAGAGTTTTTGACTTTGGGCTGGCCACTTTGATGGAACCAGATAAGATTCATGTTTCAACACTTGTAGCTGGAACTTTTGGATACTTAGCTCCTGAATATTTCGATCCGGGAAGGGCAACAGCAAAAGGGGATGTTTACAGTTTTGGAGTGGTTTTATTAGAATTTTTAACGGGAAAGAAACCTCCAGATGAAGCATTTATTGAGGAGGGTACAAAGCTTGTGACATGGGTGAAGGCAGTTTTTCAGGACAAAAAGGGGGAGTATGTGATTGACAGTAACTTAGGGTGTTGTCCAACCGATGAGATTAACAATGCCTTTAGTATTGCTTTAATGTGCCTTGAACCAGAGCCTTCCAAGAGGCCTACCATGGTTGAGGTTGTCAAGATGCTTGGGGAGATAAAAAATAACAAAGTTGTAAAAGGGACTTAAATCATATGATTAAGGCATTTCCttttttttAGACAATGTATAGATTTTATACACCAGTTTATGCCCTCAAGTGTTCCTAGCCTTTTTATCAAGAGCTTTTTTCCATCTTTaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa


Protein sequences

Name Description Sequence
Ppe.5558 translated coding region predicted by ESTScan from UniGene Ppe.5558

XRVFDFGLATLMEPDKIHVSTLVAGTFGYLAPEYFDPGRATAKGDVYSFGVVLLEFLTGKKPPDEAFIEEGTKLVTWVKAVFQDKKGEYVIDSNLGCCPTDEINNAFSIALMCLEPEPSKRPTMVEVVKMLGEIKNNKVVKGT

Domains

Domain Start-End Description Sequence

ProfileScan: PS50011
IPR000719
1-140 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

XRVFDFGLATLMEPDKIHVSTLVAGTFGYLAPEYFDPGRATAKGDVYSFGVVLLEFLTGKKPPDEAFIEEGTKLVTWVKAVFQDKKGEYVIDSNLGCCPTDEINNAFSIALMCLEPEPSKRPTMVEVVKMLGEIKNNKVV

HMMPanther: PTHR24420:SF424
2-135 SUBFAMILY NOT NAMED,SUBFAMILY NOT NAMED

RVFDFGLATLMEPDKIHVSTLVAGTFGYLAPEYFDPGRATAKGDVYSFGVVLLEFLTGKKPPDEAFIEEGTKLVTWVKAVFQDKKGEYVIDSNLGCCPTDEINNAFSIALMCLEPEPSKRPTMVEVVKMLGEIK

HMMPanther: PTHR24420
2-135 FAMILY NOT NAMED,FAMILY NOT NAMED

RVFDFGLATLMEPDKIHVSTLVAGTFGYLAPEYFDPGRATAKGDVYSFGVVLLEFLTGKKPPDEAFIEEGTKLVTWVKAVFQDKKGEYVIDSNLGCCPTDEINNAFSIALMCLEPEPSKRPTMVEVVKMLGEIK

superfamily: SSF56112
IPR011009
2-131 Protein kinase-like (PK-like)
Protein kinase-like domain

RVFDFGLATLMEPDKIHVSTLVAGTFGYLAPEYFDPGRATAKGDVYSFGVVLLEFLTGKKPPDEAFIEEGTKLVTWVKAVFQDKKGEYVIDSNLGCCPTDEINNAFSIALMCLEPEPSKRPTMVEVVKML

Gene3D: G3DSA:1.10.510.10
3-131 no description

VFDFGLATLMEPDKIHVSTLVAGTFGYLAPEYFDPGRATAKGDVYSFGVVLLEFLTGKKPPDEAFIEEGTKLVTWVKAVFQDKKGEYVIDSNLGCCPTDEINNAFSIALMCLEPEPSKRPTMVEVVKML

HMMPfam: PF00069
IPR017442
3-129 Pkinase,Ser-thr
Serine/threonine-protein kinase-like domain

VFDFGLATLMEPDKIHVSTLVAGTFGYLAPEYFDPGRATAKGDVYSFGVVLLEFLTGKKPPDEAFIEEGTKLVTWVKAVFQDKKGEYVIDSNLGCCPTDEINNAFSIALMCLEPEPSKRPTMVEVVK






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox