PRGDB00074296 (Ppe.5736)

From PRG Wiki
Jump to: navigation, search
Ppe.5736
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 51919770 (AJ826248)
Gene Class Unknown
Domain Type LRR
Gene Species Prunus persica

Comment?

AJ826248 S3 Prunus persica cDNA clone S33E11, mRNA sequence

DNA Sequence

AATTTCATAATGCATACGGGAATACTTACAAGGAAATCACTTCTTGTTAGATCAAGTGCACTCAATGTAGACACACAATCAAGAGTTCTGAGGAAATTAATTTCTGATAAATTGCTTCCTTCCAAAGTGAATGCCTCAAGTCTGGGAAGCGCTAAAGGATGTGATACTGCACTCCCCAAAACTTCAGACTTCACTTTATTTGGAAATGTAACAAGCTTTCGACTTCCTTGGAGACAAACGTGGTTTAGATGTTCCAACTCATAAATGCTGGGTGGCAGATTCGTAAGATTTTCACAATTCCTTAGGTCTAAAAATTCAAGACTGATGAGATATGCAATTGATGCAGGCAATTCTTTGACGCCACTACCAGATAGAAACATGCAACGTAAGGAATCCATCTTTCCCCCAATTTCAGGGAAAGTCTCCAGTCTTCTGCAATCTTCAAGATTGAGAACTTGTAGAGATTTTGACTGGATTATTGGAAATAGTGTGAGGTTATAGCATCTCACAAGACTCAAGTCAACAAGCTTATCATGAAATCCAACAGAAGGATGAACCTCAACTAAACTCGTGCAGTCGTCTAGATTCAAGGACTGTAAGTTTGGAATTCCAGAGATATTTGGGGTTTTTGTTAGGAATTCACAGCTCTCAAAATTCATGGaaaaaaaaaaaaaaaaaaa


Protein sequences

Name Description Sequence
Ppe.5736 translated coding region predicted by ESTScan from UniGene Ppe.5736

MNFESCEFLTKTPNISGIPNLQSLNLDDCTSLVEVHPSVGFHDKLVDLSLVRCYNLTLFPIIQSKSLQVLNLEDCRRLETFPEIGGKMDSLRCMFLSGSGVKELPASIAYLISLEFLDLRNCENLTNLPPSIYELEHLNHVCLQGSRKLVTFPNKVKSEVLGSAVSHPLALPRLEAFTLEGSNLSEINFLRTLDCVSTLSALDLTRSDFLVSIPVCIMKX


Domains

Domain Start-End Description Sequence

superfamily: SSF52058
1-219 L domain-like,LRR

MNFESCEFLTKTPNISGIPNLQSLNLDDCTSLVEVHPSVGFHDKLVDLSLVRCYNLTLFPIIQSKSLQVLNLEDCRRLETFPEIGGKMDSLRCMFLSGSGVKELPASIAYLISLEFLDLRNCENLTNLPPSIYELEHLNHVCLQGSRKLVTFPNKVKSEVLGSAVSHPLALPRLEAFTLEGSNLSEINFLRTLDCVSTLSALDLTRSDFLVSIPVCIMK

Gene3D: G3DSA:3.80.10.10
2-217 no description

NFESCEFLTKTPNISGIPNLQSLNLDDCTSLVEVHPSVGFHDKLVDLSLVRCYNLTLFPIIQSKSLQVLNLEDCRRLETFPEIGGKMDSLRCMFLSGSGVKELPASIAYLISLEFLDLRNCENLTNLPPSIYELEHLNHVCLQGSRKLVTFPNKVKSEVLGSAVSHPLALPRLEAFTLEGSNLSEINFLRTLDCVSTLSALDLTRSDFLVSIPVCI

HMMPanther: PTHR23155:SF252
13-218 SUBFAMILY NOT NAMED,SUBFAMILY NOT NAMED

PNISGIPNLQSLNLDDCTSLVEVHPSVGFHDKLVDLSLVRCYNLTLFPIIQSKSLQVLNLEDCRRLETFPEIGGKMDSLRCMFLSGSGVKELPASIAYLISLEFLDLRNCENLTNLPPSIYELEHLNHVCLQGSRKLVTFPNKVKSEVLGSAVSHPLALPRLEAFTLEGSNLSEINFLRTLDCVSTLSALDLTRSDFLVSIPVCIM

HMMPanther: PTHR23155
13-218 FAMILY NOT NAMED,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

PNISGIPNLQSLNLDDCTSLVEVHPSVGFHDKLVDLSLVRCYNLTLFPIIQSKSLQVLNLEDCRRLETFPEIGGKMDSLRCMFLSGSGVKELPASIAYLISLEFLDLRNCENLTNLPPSIYELEHLNHVCLQGSRKLVTFPNKVKSEVLGSAVSHPLALPRLEAFTLEGSNLSEINFLRTLDCVSTLSALDLTRSDFLVSIPVCIM

HMMPfam: PF00560
IPR001611
20-38 LRR_1
Leucine-rich repeat

NLQSLNLDDCTSLVEVHPS

HMMPfam: PF00560
IPR001611
66-83 LRR_1
Leucine-rich repeat

SLQVLNLEDCRRLETFPE

HMMPfam: PF00560
IPR001611
113-132 LRR_1
Leucine-rich repeat

SLEFLDLRNCENLTNLPPSI






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox