PRGDB00074297 (Ppe.5910)

From PRG Wiki
Jump to: navigation, search
Ppe.5910
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 51920506 (AJ826984)
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Prunus persica

Comment?

AJ826984 S3 Prunus persica cDNA clone S39N18, mRNA sequence

DNA Sequence

CCAGAAACATTAGCTCGAATGTGATTTTTCTTTGACTATGGTTTTTGAAAGCTCGTATAACGGATTTTGGGCTGGCGAAGGCTGGTTGCTTCTCGTGATTCCAATGATAAGCTCGTTTTGTCAATGGGGATTTGGGAGAGTTTGGTTATGTGGCTCCTGAGTACTCGAGCACAATGGTGGCATCGTTGAAAGGGGATGTGTATGGGTTCGGGGTGGTTCTTCTGGAATTGGTGACTGGACAGAAGCCTCTAGAAATTGGTAATGCAGTGGAAGGATTCAAGGGGAATTTGGTGGATTGGGTGAATCATTTATCAAACGCTGGTCGAAGCATGGATGCCATAGACAATATCTTAGCAGGGAAAGGTCACGATGATGAAATTTTGCAGTTCATGAGGGTTGCTTGTACTTGCGTGGTTGCTAGGCCAAAGGACAGGCCTTCCATGTATCAGGTTTATGAGTCATTGAAGGTCCTTGCTGAGAAACATGGTTTCTTCGAACAGTATGATGAATTTCCATTGGTCTTTGGCAAGCAGGTTCCTGAATCTTGATTTTATACAATAGTCAGGAAGGGAGAGTACTAAAAGTGCAAGATACTGCAGCATTTGGGCATGCCTTCATTGTATTATTATGGGAGGCATTTTCTGCAATTGGTATGGTTTCCGGTCGGTTGGGCATGATTTCCGTTTGTTGAATCATTGTGTATTATAAAGAAGCATTATGCATTGTAACATTTATGTAATCCAGAAAATCTCTGTTTTCAGTTATAAAATTGCTCCCTCATCTGTTCTaaaaaaaaaaaaaaaaaaa


Protein sequences

Name Description Sequence
Ppe.5910 translated coding region predicted by ESTScan from UniGene Ppe.5910

MVASLKGDVYGFGVVLLELVTGQKPLEIGNAVEGFKGNLVDWVNHLSNAGRSMDAIDNILAGKGHDDEILQFMRVACTCVVARPKDRPSMYQVYESLKVLAEKHGFFEQYDEFPLVFGKQVPES

Domains

Domain Start-End Description Sequence

superfamily: SSF56112
IPR011009
1-97 Protein kinase-like (PK-like)
Protein kinase-like domain

MVASLKGDVYGFGVVLLELVTGQKPLEIGNAVEGFKGNLVDWVNHLSNAGRSMDAIDNILAGKGHDDEILQFMRVACTCVVARPKDRPSMYQVYESL

ProfileScan: PS50011
IPR000719
1-107 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

MVASLKGDVYGFGVVLLELVTGQKPLEIGNAVEGFKGNLVDWVNHLSNAGRSMDAIDNILAGKGHDDEILQFMRVACTCVVARPKDRPSMYQVYESLKVLAEKHGFF

HMMPanther: PTHR24420:SF477
1-114 SUBFAMILY NOT NAMED,SUBFAMILY NOT NAMED

MVASLKGDVYGFGVVLLELVTGQKPLEIGNAVEGFKGNLVDWVNHLSNAGRSMDAIDNILAGKGHDDEILQFMRVACTCVVARPKDRPSMYQVYESLKVLAEKHGFFEQYDEFP

HMMPanther: PTHR24420
1-114 FAMILY NOT NAMED,FAMILY NOT NAMED

MVASLKGDVYGFGVVLLELVTGQKPLEIGNAVEGFKGNLVDWVNHLSNAGRSMDAIDNILAGKGHDDEILQFMRVACTCVVARPKDRPSMYQVYESLKVLAEKHGFFEQYDEFP

Gene3D: G3DSA:1.10.510.10
4-98 no description

SLKGDVYGFGVVLLELVTGQKPLEIGNAVEGFKGNLVDWVNHLSNAGRSMDAIDNILAGKGHDDEILQFMRVACTCVVARPKDRPSMYQVYESLK

HMMPfam: PF07714
IPR001245
4-97 Pkinase_Tyr
Serine-threonine/tyrosine-protein kinase

SLKGDVYGFGVVLLELVTGQKPLEIGNAVEGFKGNLVDWVNHLSNAGRSMDAIDNILAGKGHDDEILQFMRVACTCVVARPKDRPSMYQVYESL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox