PRGDB00074302 (Ppe.7068)

From PRG Wiki
Jump to: navigation, search
Ppe.7068
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 84627963 (DW341573)
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Prunus persica

Comment?

PP_LEc0005B20f Peach shoot Prunus persica cDNA clone PP_LEc0005B20f, mRNA sequence

DNA Sequence

ACTAAGTGGGATCCCCCCGGGCTGCAGGGAGGTCTCCCTATTTTAGCATTTAATTAAAGTTACAGTTGGAAACTTTCCAACTAGttttgttttttttCTTCCTTCTAGTTTTTATATCCCCATCAGCTTGTTGATGGTTAGCATGCCAAATGGTAAAGGAAGGGAAGGCAGACTCTGAGCTGATAGTTTTTGTGCTACGTAAAGCATTGTAGGTCGAGACCCTGGACGCATACGTATACAAGCCAAGGCTAAACTCATCACAAGCACCACTGCCTTTGCCAATTCATTGCTTGGAGCCTCCAGCCTTTCGTCTAACAAATCCTTCAAAAACAACTCTGCATTGTCCTCCTTCATTGATTGTGATGATTCTGATAGCTGGGATTCTAGCAGATCCCCTGGGTGCCTTCCCATCATAACTTCCAGCGCCACTACTCCAAAGCTATACACATCACACTTAGCCGTGACTCGCATTGTCAATGCAAGCTCTGCACATCAAGAGAAAAACAAACCAAGTTGTCTCAAAACATATCTCTGCCACCAAAACATGATCCAAAAATGCACAACGTTAAATTGGTATGTTACCTGGTGCCATGTAGCCAAATGAGCCAACAATATGGGTCCAGTTGGATGAATTAGCACTAATCAGTCTTGCTGTTCCAAAATCGGAAAGTCGGGCTTCGAAATCCGACTCCAGCAATACATTGTTGACAGTTACATCACGGTGCACAATTGGTGGAGAGCAGTCATGGTGCAAGTAAGAAAGTGCATGAGCTAATCCTTTCACAACTTTGACCCTTGTAGCCCATCCCAGTTCAGTTACCCCTTCAACCCCATACAATGCCTTTCCCAGGCTGCCTCTCTCTAAATATTCATAAAGCAAGAAAATGCATCCCCTCCTGAACAGAACCCATATAGCCCAATGGAGTTCCTTGCCGGACATTTGGCAAAGTTAGGATTTCTTTCTCGAAACTTTGAAAATTGATTGGTGGAATGTCCTTAGAGTCTGAAATGTTAAGCCTCTTACTGCAACACCTTGCCTGAAACCAACTCTCCTTTGATCCTCTTCCAAATCCCCCTTTTCCAAAAAGTACTTTTCCTTAAAATCCTCTATGGCCTTTTAAACTTCCCAAAACGAAAATTTAttttttttcttgcaatatattttgatcaaaaattctcaaaaattttggggggaaaattattggatttttttaaaaggcccacttttggtttttctttttGGGAAACAAAAAA


Protein sequences

Name Description Sequence
Ppe.7068 translated coding region predicted by ESTScan from UniGene Ppe.7068

MSGKELHWAIWVLFRRGCIFLLYEYLERGSLGKALYGVEGVTELGWATRVKVVKGLAHALSYLHHDCSPPIVHRDVTVNNVLLESDFEARLSDFGTARLISANSSNWTHIVGSFGYMAPGNNQFNVVHFWIMFWWQRYVLRQLGLFFSXCAELALTMRVTAKCDVYSFGVVALEVMMGRHPGDLLESQLSESSQSMKEDNAELFLKDLLDERLEAPSNELAKAVVLVMSLALACIRMRPGSRPTMLYVAQKLSAQSLPSLPLPFGMLTINKLMGI

Domains

Domain Start-End Description Sequence

ProfileScan: PS50011
IPR000719
1-260 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

MSGKELHWAIWVLFRRGCIFLLYEYLERGSLGKALYGVEGVTELGWATRVKVVKGLAHALSYLHHDCSPPIVHRDVTVNNVLLESDFEARLSDFGTARLISANSSNWTHIVGSFGYMAPGNNQFNVVHFWIMFWWQRYVLRQLGLFFSXCAELALTMRVTAKCDVYSFGVVALEVMMGRHPGDLLESQLSESSQSMKEDNAELFLKDLLDERLEAPSNELAKAVVLVMSLALACIRMRPGSRPTMLYVAQKLSAQSLPSL

HMMSmart: SM00220
IPR002290
1-260 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

MSGKELHWAIWVLFRRGCIFLLYEYLERGSLGKALYGVEGVTELGWATRVKVVKGLAHALSYLHHDCSPPIVHRDVTVNNVLLESDFEARLSDFGTARLISANSSNWTHIVGSFGYMAPGNNQFNVVHFWIMFWWQRYVLRQLGLFFSXCAELALTMRVTAKCDVYSFGVVALEVMMGRHPGDLLESQLSESSQSMKEDNAELFLKDLLDERLEAPSNELAKAVVLVMSLALACIRMRPGSRPTMLYVAQKLSAQSLPSL

HMMSmart: SM00219
IPR020635
4-252 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

KELHWAIWVLFRRGCIFLLYEYLERGSLGKALYGVEGVTELGWATRVKVVKGLAHALSYLHHDCSPPIVHRDVTVNNVLLESDFEARLSDFGTARLISANSSNWTHIVGSFGYMAPGNNQFNVVHFWIMFWWQRYVLRQLGLFFSXCAELALTMRVTAKCDVYSFGVVALEVMMGRHPGDLLESQLSESSQSMKEDNAELFLKDLLDERLEAPSNELAKAVVLVMSLALACIRMRPGSRPTMLYVAQKL

superfamily: SSF56112
IPR011009
10-252 Protein kinase-like (PK-like)
Protein kinase-like domain

IWVLFRRGCIFLLYEYLERGSLGKALYGVEGVTELGWATRVKVVKGLAHALSYLHHDCSPPIVHRDVTVNNVLLESDFEARLSDFGTARLISANSSNWTHIVGSFGYMAPGNNQFNVVHFWIMFWWQRYVLRQLGLFFSXCAELALTMRVTAKCDVYSFGVVALEVMMGRHPGDLLESQLSESSQSMKEDNAELFLKDLLDERLEAPSNELAKAVVLVMSLALACIRMRPGSRPTMLYVAQKL

HMMPfam: PF00069
IPR017442
18-248 Pkinase,Ser-thr
Serine/threonine-protein kinase-like domain

CIFLLYEYLERGSLGKALYGVEGVTELGWATRVKVVKGLAHALSYLHHDCSPPIVHRDVTVNNVLLESDFEARLSDFGTARLISANSSNWTHIVGSFGYMAPGNNQFNVVHFWIMFWWQRYVLRQLGLFFSXCAELALTMRVTAKCDVYSFGVVALEVMMGRHPGDLLESQLSESSQSMKEDNAELFLKDLLDERLEAPSNELAKAVVLVMSLALACIRMRPGSRPTMLYV

HMMPanther: PTHR24420:SF501
19-254 SUBFAMILY NOT NAMED,SUBFAMILY NOT NAMED

IFLLYEYLERGSLGKALYGVEGVTELGWATRVKVVKGLAHALSYLHHDCSPPIVHRDVTVNNVLLESDFEARLSDFGTARLISANSSNWTHIVGSFGYMAPGNNQFNVVHFWIMFWWQRYVLRQLGLFFSXCAELALTMRVTAKCDVYSFGVVALEVMMGRHPGDLLESQLSESSQSMKEDNAELFLKDLLDERLEAPSNELAKAVVLVMSLALACIRMRPGSRPTMLYVAQKLSA

HMMPanther: PTHR24420
19-254 FAMILY NOT NAMED,FAMILY NOT NAMED

IFLLYEYLERGSLGKALYGVEGVTELGWATRVKVVKGLAHALSYLHHDCSPPIVHRDVTVNNVLLESDFEARLSDFGTARLISANSSNWTHIVGSFGYMAPGNNQFNVVHFWIMFWWQRYVLRQLGLFFSXCAELALTMRVTAKCDVYSFGVVALEVMMGRHPGDLLESQLSESSQSMKEDNAELFLKDLLDERLEAPSNELAKAVVLVMSLALACIRMRPGSRPTMLYVAQKLSA

PatternScan: PS00109
IPR008266
71-83 PROTEIN_KINASE_TYR
Tyrosine-protein kinase, active site

IVHRDVTVNNVLL

Gene3D: G3DSA:1.10.510.10
157-252 no description

MRVTAKCDVYSFGVVALEVMMGRHPGDLLESQLSESSQSMKEDNAELFLKDLLDERLEAPSNELAKAVVLVMSLALACIRMRPGSRPTMLYVAQKL

Seg: seg
184-195 seg

LLESQLSESSQS

Seg: seg
252-263 seg

LSAQSLPSLPLP






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox