PRGDB00074304 (Ppe.7208)

From PRG Wiki
Jump to: navigation, search
Ppe.7208
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 89001902 (DN552823)
Gene Class Unknown
Domain Type LRR
Gene Species Prunus persica

Comment?

HPL-01-B09 Prunus persica L. leaf tissue, healthy Prunus persica cDNA, mRNA sequence

DNA Sequence

TCAACTACTTCGCCGGTTCAGTCACACCGGAAGTCTTCAAACTAGATGTTGATGTGCTCTTCCTCAACAACAACAATTTCAATCAGAAGATTCCTGACAATCTTGGTTCCTCACCAGCCCATTACTTCACTTTTGCTAACAACAAGTTCACTGGTCCAATCCCAAGAAGCATTGGCCAAGCATGCAAAACCCTTTATGAGGTTCTCTTCCTTGGGAACAAACTTACAGGGTGCCTGCCGTATGAAATTGGGTACTTAAACCAGGCCACGGTGTTCGATGTGAGCTCGAACTTATTAACAGGCCCAATACCACATTCATTCAGCTGCTTGGCCAAGATTGAGTATCTAAACTTGGCCAGCAACAGGTTCTATGGGCCAGTGCCAGAGCAGGTCTGCACCTTGTCTAATCTGGGGAACTTTTCCTTGGCCAACAACTATTTCACAGAGGTCGGCCCAGAGTGCAGGAAATTGATGAAGAAGAAGCTTCTTGATGTTAGGCAGAA


Protein sequences

Name Description Sequence
Ppe.7208 translated coding region predicted by ESTScan from UniGene Ppe.7208

XNYFAGSVTPEVFKLDVDVLFLNNNNFNQKIPDNLGSSPAHYFTFANNKFTGPIPRSIGQACKTLYEVLFLGNKLTGCLPYEIGYLNQATVFDVSSNLLTGPIPHSFSCLAKIEYLNLASNRFYGPVPEQVCTLSNLGNFSLANNYFTEVGPECRKLMKKKLLDVRQX

Domains

Domain Start-End Description Sequence

Gene3D: G3DSA:3.80.10.10
2-166 no description

NYFAGSVTPEVFKLDVDVLFLNNNNFNQKIPDNLGSSPAHYFTFANNKFTGPIPRSIGQACKTLYEVLFLGNKLTGCLPYEIGYLNQATVFDVSSNLLTGPIPHSFSCLAKIEYLNLASNRFYGPVPEQVCTLSNLGNFSLANNYFTEVGPECRKLMKKKLLDVR

HMMPanther: PTHR24420:SF937
2-161 SUBFAMILY NOT NAMED

NYFAGSVTPEVFKLDVDVLFLNNNNFNQKIPDNLGSSPAHYFTFANNKFTGPIPRSIGQACKTLYEVLFLGNKLTGCLPYEIGYLNQATVFDVSSNLLTGPIPHSFSCLAKIEYLNLASNRFYGPVPEQVCTLSNLGNFSLANNYFTEVGPECRKLMKKK

HMMPanther: PTHR24420
2-161 FAMILY NOT NAMED,FAMILY NOT NAMED

NYFAGSVTPEVFKLDVDVLFLNNNNFNQKIPDNLGSSPAHYFTFANNKFTGPIPRSIGQACKTLYEVLFLGNKLTGCLPYEIGYLNQATVFDVSSNLLTGPIPHSFSCLAKIEYLNLASNRFYGPVPEQVCTLSNLGNFSLANNYFTEVGPECRKLMKKK

Seg: seg
15-28 seg

LDVDVLFLNNNNFN

superfamily: SSF52058
19-167 L domain-like,LRR

VLFLNNNNFNQKIPDNLGSSPAHYFTFANNKFTGPIPRSIGQACKTLYEVLFLGNKLTGCLPYEIGYLNQATVFDVSSNLLTGPIPHSFSCLAKIEYLNLASNRFYGPVPEQVCTLSNLGNFSLANNYFTEVGPECRKLMKKKLLDVRQ






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox