PRGDB00074305 (Ppe.7261)

From PRG Wiki
Jump to: navigation, search
Ppe.7261
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 89002251 (DN553172)
Gene Class Unknown
Domain Type
Gene Species Prunus persica

Comment?

PPL04-D01 Prunus persica L. leaf tissue, Plum Pox Virus infected Prunus persica cDNA, mRNA sequence

DNA Sequence

GAGGGCGCACACTATAAAAGCAATATGCATTGTTCACAATGAAACAGCCACTGGAGTTACTAATAACTTAGCTCAAGTGAGAAGAATACTTGATGAGTACAGACATCCAGCTCTCTTTCTTGTTGATGGAGTGTCTTCCATATGTGCTCTTGACTTCCGTATGGATGAATGGGGAGTAGATGTAGCTTTAACTGGTTCTCAGAAAGCTCTTTCTCTCCCCACTGGCATTGGGATTGTGTGTGCAAGCCCAAAAGCTCTAGAGGCATCTAAAACTGCAAAGTCAGTAAGAGTTTTCTTTGACTGGAATGATTACTTGAAGTTCTATAAGTTGGGAACATACTGGCCATATACCCCTTCCATCCAGTTGCTGTATGGACTGCGCACAGCACTTGATCTTATTTTTGAGGAAGGACTTGACAACGTGATTGCAAGACACAGCCGTTTGGGAAAAGCAACAAGGCTTGCTGTGGAGGCATGGGGCTTGAAGAACTGCACCCAAAGTGAGGAATGGTTCAGTGAC


Protein sequences

Name Description Sequence
Ppe.7261 translated coding region predicted by ESTScan from UniGene Ppe.7261

XRAHTIKAICIVHNETATGVTNNLAQVRRILDEYRHPALFLVDGVSSICALDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWNDYLKFYKLGTYWPYTPSIQLLYGLRTALDLIFEEGLDNVIARHSRLGKATRLAVEAWGLKNCTQSEEWFSD

Domains

Domain Start-End Description Sequence

superfamily: SSF53383
IPR015424
2-173 PLP-dependent transferases
Pyridoxal phosphate-dependent transferase, major d

RAHTIKAICIVHNETATGVTNNLAQVRRILDEYRHPALFLVDGVSSICALDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWNDYLKFYKLGTYWPYTPSIQLLYGLRTALDLIFEEGLDNVIARHSRLGKATRLAVEAWGLKNCTQSEEWFS

HMMPfam: PF00266
IPR000192
4-162 Aminotran_5
Aminotransferase, class V/Cysteine desulfurase

HTIKAICIVHNETATGVTNNLAQVRRILDEYRHPALFLVDGVSSICALDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWNDYLKFYKLGTYWPYTPSIQLLYGLRTALDLIFEEGLDNVIARHSRLGKATRLAVEAWGL

HMMPanther: PTHR21152:SF7
4-174 SUBFAMILY NOT NAMED,SUBFAMILY NOT NAMED

HTIKAICIVHNETATGVTNNLAQVRRILDEYRHPALFLVDGVSSICALDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWNDYLKFYKLGTYWPYTPSIQLLYGLRTALDLIFEEGLDNVIARHSRLGKATRLAVEAWGLKNCTQSEEWFSD

HMMPanther: PTHR21152
4-174 FAMILY NOT NAMED,AMINOTRANSFERASE CLASS V

HTIKAICIVHNETATGVTNNLAQVRRILDEYRHPALFLVDGVSSICALDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWNDYLKFYKLGTYWPYTPSIQLLYGLRTALDLIFEEGLDNVIARHSRLGKATRLAVEAWGLKNCTQSEEWFSD

Gene3D: G3DSA:3.40.640.10
IPR015421
4-125 no description
Pyridoxal phosphate-dependent transferase, major r

HTIKAICIVHNETATGVTNNLAQVRRILDEYRHPALFLVDGVSSICALDFRMDEWGVDVALTGSQKALSLPTGIGIVCASPKALEASKTAKSVRVFFDWNDYLKFYKLGTYWPYTPSIQLLY

PatternScan: PS00595
IPR020578
60-80 AA_TRANSFER_CLASS_5
Aminotransferase class-V pyridoxal-phosphate bindi

VDVALTGSQKALSLPTGIGIV

Gene3D: G3DSA:3.90.1150.10
IPR015422
126-172 no description
Pyridoxal phosphate-dependent transferase, major r

GLRTALDLIFEEGLDNVIARHSRLGKATRLAVEAWGLKNCTQSEEWF






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox