PRGDB00074306 (Ppe.7411)

From PRG Wiki
Jump to: navigation, search
Ppe.7411
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 89003209 (DN554130)
Gene Class Unknown
Domain Type
Gene Species Prunus persica

Comment?

PPL-08-_T3__B01 Prunus persica L. leaf tissue, Plum Pox Virus infected Prunus persica cDNA, mRNA sequence

DNA Sequence

TCAGTGACACAGTGACAGCTGTGCTGGTTCCTCCATACATTGACAGTACAGAAATTGTGAGAAGGGCATGGAAAAGATATAATTTGAGCTTAGGCCTAGGCCTAAACAAAATAGCTGGCAAGGTTTTCAGAATAGGGCATCTTGGCAATCTGAATGAGTTGCAATTGCTGGGTTGTCTTGCTGGTGTCGAGATGGTACTTAGGGATGTGGGCTACCCTGTTAAGCTAGGAAGCGGAGTTGCAGCTGCTAGTGCATACTTTCAGAACAACACCCCTCTGATCCCTTCCAGGATTTGATTTTCCGTCTATCATTGTAATTTATTTTCCTCTATGCTTTGCGTCAGGATGTACTGTAAATAACGCGTATTTGTTCCTCTCCTTGCACTCTCTTGAGGCTATCCAAATTCCCTATTTAATACATGGTCTTTTGGATGTTCCTATGTCTGTAATTTGAGTAGAATCTTTTGCTTGCTCATTTTATTCCAATTTTTCTT


Protein sequences

Name Description Sequence
Ppe.7411 translated coding region predicted by ESTScan from UniGene Ppe.7411

XSDTVTAVLVPPYIDSTEIVRRAWKRYNLSLGLGLNKIAGKVFRIGHLGNLNELQLLGCLAGVEMVLRDVGYPVKLGSGVAAASAYFQNNTPLIPSRI

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR21152:SF7
2-98 SUBFAMILY NOT NAMED,SUBFAMILY NOT NAMED

SDTVTAVLVPPYIDSTEIVRRAWKRYNLSLGLGLNKIAGKVFRIGHLGNLNELQLLGCLAGVEMVLRDVGYPVKLGSGVAAASAYFQNNTPLIPSRI

HMMPanther: PTHR21152
2-98 FAMILY NOT NAMED,AMINOTRANSFERASE CLASS V

SDTVTAVLVPPYIDSTEIVRRAWKRYNLSLGLGLNKIAGKVFRIGHLGNLNELQLLGCLAGVEMVLRDVGYPVKLGSGVAAASAYFQNNTPLIPSRI

Gene3D: G3DSA:3.90.1150.10
IPR015422
2-80 no description
Pyridoxal phosphate-dependent transferase, major r

SDTVTAVLVPPYIDSTEIVRRAWKRYNLSLGLGLNKIAGKVFRIGHLGNLNELQLLGCLAGVEMVLRDVGYPVKLGSGV

superfamily: SSF53383
IPR015424
2-72 PLP-dependent transferases
Pyridoxal phosphate-dependent transferase, major d

SDTVTAVLVPPYIDSTEIVRRAWKRYNLSLGLGLNKIAGKVFRIGHLGNLNELQLLGCLAGVEMVLRDVGY






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox