PRGDB00074307 (Ppe.9744)

From PRG Wiki
Jump to: navigation, search
Ppe.9744
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 84629077 (DW342687)
Gene Class Unknown
Domain Type LRR
Gene Species Prunus persica

Comment?

PP_LEc0011K17f Peach shoot Prunus persica cDNA clone PP_LEc0011K17f, mRNA sequence

DNA Sequence

GTAGATTTGCCCACAGTAAAAGCGGACAATGTTCTCAAGCTTTTCAATGTACTCATTTGCCTTGGCATCTCTACAATTTTAGTTCCACTGAAGTCAAGATGATGCAAATTAATTAATTCACACATGTCTACAGGCAATTTAGTAAGAGACGTACAACCTCCCAACATTAATTTCTGTAAATTTATCAATTTTCTCAAGTCTGCAGGTAATTCAACGAGACGAGAACAAGTTGACAATAATAATGTCTGCAAATTGTAGAGGCTGCAAAGTACACTGGGTAACGTTTCAATTGCAGTATCGGAGAGATCCAAATAGCGCAAGTGAATGAGCTTTTTAATGGAATCAGGTAACTCAGTGACATTCTCATAACAGGACAACGACAACACCCGTAAACATGTTAGTGATGCCAACAAATTATGCAGAACCTTTTTACTTACATAATAACTGTCAATATTAATGTACCTATAATATGGTTTTAAAGAGATAGATAGAAAGGTACGCAAACACTTAGCCCCTTTTAATGGCTCAAATTTAACAGCAACATCTAATTTCTCCTTGGCATAAGACAAATGGCGAACTCTTTCTACTTCATGTGATTCCCTCCCTTCCCACCTGGAGCAAAATCCTTTAGACATGAACACCGCCAAGTCATTGATGAGATCATGCATGACGAAACTTGATTTCCCTGACGTTTGAAACAATGATCGGGATAACAATTCATCAAAATATTCTTTAGCCACCTCTTCCATGTTGTCTCCATTCTCCGCTTGGGGAATTAAACCTTCCGCCATCCAAAGAAAAACAACATTTTCTACCTTGAATACATAGTCTTTTGGAAAAATTGAACAATAAATAAAGCATCGCTTTAACTTAGCTGGAAGAATATGATAACTCAATCCTAGAGCGGGAAAGATGTCACTTTTCTCGTAAGGTACTCCCAAATNGTGCCTGTTAGTACTCTGGTCCATACCTCAGAGTCTGGCCTCGAACGTAACACACCCCAAAGTGTTTGCGCAGCTAAAAGCAACCCAATTGCACTTGCGTGCAATTTTCTTGGCGAATTTCTCCCAAGCTTTGGAATCTGAACTAAAAAATTAAATTTGGCTTGTTTTTTGCAAGAAAGAAACCAACAAACTTCTCGGGCaaaaaaggggtttcaggggggggaaaaagaaaaatttttgttagaaaaaaaagctaatttttttttttCTCCGGGTGGTTTGCAAAGAAAATTTTACTTTCCTCTTTTCCCCCCCGCAAGAAAAAGAAAGGAGATgggggagggggggggggATCCCCACAAAAAATAATTTATTTT


Protein sequences

Name Description Sequence
Ppe.9744 translated coding region predicted by ESTScan from UniGene Ppe.9744

MAEGLIPQAENGDNMEEVAKEYFDELLSRSLFQTSGKSSFVMHDLINDLAVFMSKGFCSRWEGRESHEVERVRHLSYAKEKLDVAVKFEPLKGAKCLRTFLSISLKPYYRYINIDSYYVSKKVLHNLLASLTCLRVLSLSCYENVTELPDSIKKLIHLRYLDLSDTAIETLPSVLCSLYNLQTLLLSTCSRLVELPADLRKLINLQKLMLGGCTSLTKLPVDMCELINLHHLDFSGTKIVEMPRQMSTLKSLRTLSAFTVGKST


Domains

Domain Start-End Description Sequence

superfamily: SSF52058
41-256 L domain-like,LRR

VMHDLINDLAVFMSKGFCSRWEGRESHEVERVRHLSYAKEKLDVAVKFEPLKGAKCLRTFLSISLKPYYRYINIDSYYVSKKVLHNLLASLTCLRVLSLSCYENVTELPDSIKKLIHLRYLDLSDTAIETLPSVLCSLYNLQTLLLSTCSRLVELPADLRKLINLQKLMLGGCTSLTKLPVDMCELINLHHLDFSGTKIVEMPRQMSTLKSLRTLS

Gene3D: G3DSA:3.80.10.10
106-256 no description

KPYYRYINIDSYYVSKKVLHNLLASLTCLRVLSLSCYENVTELPDSIKKLIHLRYLDLSDTAIETLPSVLCSLYNLQTLLLSTCSRLVELPADLRKLINLQKLMLGGCTSLTKLPVDMCELINLHHLDFSGTKIVEMPRQMSTLKSLRTLS

HMMPanther: PTHR23155:SF121
122-256 SUBFAMILY NOT NAMED,SUBFAMILY NOT NAMED

KVLHNLLASLTCLRVLSLSCYENVTELPDSIKKLIHLRYLDLSDTAIETLPSVLCSLYNLQTLLLSTCSRLVELPADLRKLINLQKLMLGGCTSLTKLPVDMCELINLHHLDFSGTKIVEMPRQMSTLKSLRTLS

HMMPanther: PTHR23155
122-256 FAMILY NOT NAMED,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

KVLHNLLASLTCLRVLSLSCYENVTELPDSIKKLIHLRYLDLSDTAIETLPSVLCSLYNLQTLLLSTCSRLVELPADLRKLINLQKLMLGGCTSLTKLPVDMCELINLHHLDFSGTKIVEMPRQMSTLKSLRTLS

HMMPfam: PF13855
134-189 LRR_8,Leucine rich repeat

LRVLSLSCYENVTELPDSIKKLIHLRYLDLSDTAIETLPSVLCSLYNLQTLLLSTC

HMMSmart: SM00369
IPR003591
155-178 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

LIHLRYLDLSDTAIETLPSVLCSL

HMMPfam: PF00560
IPR001611
204-224 LRR_1
Leucine-rich repeat

NLQKLMLGGCTSLTKLPVDMC

HMMSmart: SM00369
IPR003591
226-249 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

LINLHHLDFSGTKIVEMPRQMSTL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox