PRGDB00074308 (Ppe.12228)

From PRG Wiki
Jump to: navigation, search
Ppe.12228
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 84632882 (DW346492)
Gene Class Unknown
Domain Type
Gene Species Prunus persica

Comment?

PP_LEc0008L04f Peach shoot Prunus persica cDNA clone PP_LEc0008L04f, mRNA sequence

DNA Sequence

ACTAGGTGGATCCCCCGGGGCTGCAGGCTCCAGCCTTGCGTGAATTTGGAGCAACTAACCATCAAATTCTATGGCGGAACCAACTTCCCGAATTGGTTAGGAGACTCGTCCTTCTCTAACATACAAGTCATGCATCTCAGTGATTGCAGTTATTGTTGGTCGATGCCACCAGTCGGGGAGTTGCCCGCTCTTAAAGAGCTCTGTATAAAAAGGAAGAAATGGGGCTTCTCTTATTCAGCCATTTCAATCACTGGAGAAGCTGGGGTTTGAGGAGATGCCAGATTGGGAGGAATGGATTCCAAGTGGAAGTGGAGATCAATATCGTCCAGACTTTCCTTGTCTTATGGAGCTGATTCTAAAAAAGTGTCCGAAGCTGAGAGGAAACTTGCCTTGAGAAGCTTAGCGTGTCTGGATGTGGGGTTTTACATGATCAAAGGGCCACTACTACTACCATTAGTAGCCTTAACATGTACTCCTACAAATCTCTAGAAGAATTGAAAATAGAAGATGGATGTGTTGTGCGGAAGCGTCAACCAACTGTGAGTGAAAAATAAACAACTACTGGCAGGaaaaaaaaa


Protein sequences

Name Description Sequence
Ppe.12228 translated coding region predicted by ESTScan from UniGene Ppe.12228

TRWIPRGCRLQPCVNLEQLTIKFYGGTNFPNWLGDSSFSNIQVMHLSDCSYCWSMPPVGELPALKELCIKRKKWGFSYSAISITGEAGVXGDARLGGMDSKWKWRSISSRLSLSYGADSKKVSEAERKLALEKLSVSGCGVLHDQRATTTTISSLNMYSYKSLEELKIEDGCVVRKRQPTVSEK







List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox