PRGDB00074310 (Ppe.12479)

From PRG Wiki
Jump to: navigation, search
Ppe.12479
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 84633241 (DW346851)
Gene Class Unknown
Domain Type LRR
Gene Species Prunus persica

Comment?

PP_LEc0011O07f Peach shoot Prunus persica cDNA clone PP_LEc0011O07f, mRNA sequence

DNA Sequence

CTCGCAGGACTTCACGTGGCTTAAGTTAGACAATAATAATTTGACGATTGATACTTCGACTCCAGAAGCAAACACTCTCTCTTGTTTGGTTAATCTTAGAAGTTTGACAATATTAGCCTTGGCAGCTAATCCGTTAAATGCCAGACTTGATGATTCCTTTCGGAATTGCTCTACATCGTCGCTTCAATATATTTATTTATACTATTGCAACATGAGGGGTGACATTCCCATTGGTATTGGCAACTTGAGCAGCCTGGTAATGTTATCCATGAGAGGCAATCAATTGAGTGGATCAATTCCAGCTTCACTGAGAAGACTAGGGAATCTCCAAGCTTTGTTCTTGACTGATAACAAGTTGCGAGGGTACATCCCATATCAACTATGTCAATTAGATAACCTAGCTTACTTATTTTTGAGTAGTAATCAGCTCTATGGTTCTATACCTTCTTGCTTGGGAAATCTAACCGCATCTCTAAGATATCTATCATTGGCGTCCAATTCGTTGAGTTCCACAATACCATCTACCTTTTGGAGACTTGCCTATATCTTGTACGTAAACTTATCATCCAATTATCTAATTGGACATCTCTCACAAGATATTGGAAACTTGAAGGTCGTGACAGAGGTAGATTTATCAAATAACAATTTATCTGGTATCCTACCAAGCACTATTGGGGGTCTTCGGGATTTGGTTAATCTACCCCTAGCAAATAATAATTTGGAAGGCCATATTCCAAGTTCATTTGACGGGTTGCTAAGCCTGCAACTCTTGGATTTGTCCAGAAACAATCTGTCTGGAGTGATTCCCAAGTCTTTAGAAGCTCTGTTACTTTCTCAGTATATGGATGTGTCTTTCAACAGGCTCCAAGGAGAAATTCCAACTGGNTGGACCGTTCCAAATTTCTCCGCTCAATCATTTGTCTCAAAACAAGCACTCTGTGGTGCAGCCCGACTTCAGGTTCCACATGCAAAAATGGTACACTGGAACCNAATTGGAGGAAAGCTAAATATATCATCCCAGGGATTATATCAGTAAATCCTCTGTGGGCTCTGTATCTATCTTTGTACTACGCAGGAAAAGGGATGGGGAAAGTTGCAAAAAAAGCTACCTCCTTGCCTCCACTTCTTTGGAAAAAAATTTCCCTGGTAAAATTTCTAGGGGGCCCCAAGGGATTTAAGAAAAAAACCACCTTGGAAAAGGGGGGGTTTGGGGTTTCTATATATAAGGGACACCTTTTTTAAAAGAAAAATAAATTTGTGCGAAAAAGGGGtttttttttttttacaaaaaaaaa


Protein sequences

Name Description Sequence
Ppe.12479 translated coding region predicted by ESTScan from UniGene Ppe.12479

XSQDFTWLKLDNNNLTIDTSTPEANTLSCLVNLRSLTILALAANPLNARLDDSFRNCSTSSLQYIYLYYCNMRGDIPIGIGNLSSLVMLSMRGNQLSGSIPASLRRLGNLQALFLTDNKLRGYIPYQLCQLDNLAYLFLSSNQLYGSIPSCLGNLTASLRYLSLASNSLSSTIPSTFWRLAYILYVNLSSNYLIGHLSQDIGNLKVVTEVDLSNNNLSGILPSTIGGLRDLVNLPLANNNLEGHIPSSFDGLLSLQLLDLSRNNLSGVIPKSLEALLLSQYMDVSFNRLQGEIPTGWTVPNFSAQSFVSKQALCGAARLQVPHAKMVHWNXIGGKLNISSQGLYQ


Domains

Domain Start-End Description Sequence

Gene3D: G3DSA:3.80.10.10
6-167 no description

TWLKLDNNNLTIDTSTPEANTLSCLVNLRSLTILALAANPLNARLDDSFRNCSTSSLQYIYLYYCNMRGDIPIGIGNLSSLVMLSMRGNQLSGSIPASLRRLGNLQALFLTDNKLRGYIPYQLCQLDNLAYLFLSSNQLYGSIPSCLGNLTASLRYLSLASN

HMMPanther: PTHR24420:SF474
30-315 SUBFAMILY NOT NAMED,SUBFAMILY NOT NAMED

LVNLRSLTILALAANPLNARLDDSFRNCSTSSLQYIYLYYCNMRGDIPIGIGNLSSLVMLSMRGNQLSGSIPASLRRLGNLQALFLTDNKLRGYIPYQLCQLDNLAYLFLSSNQLYGSIPSCLGNLTASLRYLSLASNSLSSTIPSTFWRLAYILYVNLSSNYLIGHLSQDIGNLKVVTEVDLSNNNLSGILPSTIGGLRDLVNLPLANNNLEGHIPSSFDGLLSLQLLDLSRNNLSGVIPKSLEALLLSQYMDVSFNRLQGEIPTGWTVPNFSAQSFVSKQALCG

HMMPanther: PTHR24420
30-315 FAMILY NOT NAMED,FAMILY NOT NAMED

LVNLRSLTILALAANPLNARLDDSFRNCSTSSLQYIYLYYCNMRGDIPIGIGNLSSLVMLSMRGNQLSGSIPASLRRLGNLQALFLTDNKLRGYIPYQLCQLDNLAYLFLSSNQLYGSIPSCLGNLTASLRYLSLASNSLSSTIPSTFWRLAYILYVNLSSNYLIGHLSQDIGNLKVVTEVDLSNNNLSGILPSTIGGLRDLVNLPLANNNLEGHIPSSFDGLLSLQLLDLSRNNLSGVIPKSLEALLLSQYMDVSFNRLQGEIPTGWTVPNFSAQSFVSKQALCG

superfamily: SSF52058
32-322 L domain-like,LRR

NLRSLTILALAANPLNARLDDSFRNCSTSSLQYIYLYYCNMRGDIPIGIGNLSSLVMLSMRGNQLSGSIPASLRRLGNLQALFLTDNKLRGYIPYQLCQLDNLAYLFLSSNQLYGSIPSCLGNLTASLRYLSLASNSLSSTIPSTFWRLAYILYVNLSSNYLIGHLSQDIGNLKVVTEVDLSNNNLSGILPSTIGGLRDLVNLPLANNNLEGHIPSSFDGLLSLQLLDLSRNNLSGVIPKSLEALLLSQYMDVSFNRLQGEIPTGWTVPNFSAQSFVSKQALCGAARLQVP

HMMSmart: SM00369
IPR003591
33-56 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

LRSLTILALAANPLNARLDDSFRN

Seg: seg
39-50 seg

LALAANPLNARL

HMMPfam: PF00560
IPR001611
61-83 LRR_1
Leucine-rich repeat

SLQYIYLYYCNMRGDIPIGIGNL

HMMSmart: SM00369
IPR003591
83-107 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

LSSLVMLSMRGNQLSGSIPASLRRL

HMMSmart: SM00369
IPR003591
131-155 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

LDNLAYLFLSSNQLYGSIPSCLGNL

HMMPfam: PF00560
IPR001611
133-155 LRR_1
Leucine-rich repeat

NLAYLFLSSNQLYGSIPSCLGNL

HMMSmart: SM00369
IPR003591
156-180 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

TASLRYLSLASNSLSSTIPSTFWRL

HMMPfam: PF00560
IPR001611
158-180 LRR_1
Leucine-rich repeat

SLRYLSLASNSLSSTIPSTFWRL

Gene3D: G3DSA:3.80.10.10
168-295 no description

SLSSTIPSTFWRLAYILYVNLSSNYLIGHLSQDIGNLKVVTEVDLSNNNLSGILPSTIGGLRDLVNLPLANNNLEGHIPSSFDGLLSLQLLDLSRNNLSGVIPKSLEALLLSQYMDVSFNRLQGEIPT

HMMSmart: SM00369
IPR003591
204-227 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

LKVVTEVDLSNNNLSGILPSTIGG

FPrintScan: PR00019
207-220 LEURICHRPT,Leucine-rich repeat signature

VTEVDLSNNNLSGI

HMMPfam: PF00560
IPR001611
208-228 LRR_1
Leucine-rich repeat

TEVDLSNNNLSGILPSTIGGL

Seg: seg
247-266 seg

SSFDGLLSLQLLDLSRNNLS

FPrintScan: PR00019
252-265 LEURICHRPT,Leucine-rich repeat signature

LLSLQLLDLSRNNL

HMMSmart: SM00369
IPR003591
252-275 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

LLSLQLLDLSRNNLSGVIPKSLEA

HMMPfam: PF00560
IPR001611
254-276 LRR_1
Leucine-rich repeat

SLQLLDLSRNNLSGVIPKSLEAL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox