PRGDB00074311 (Ppe.13525)

From PRG Wiki
Jump to: navigation, search
Ppe.13525
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 209172722 (FC862060)
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Prunus persica

Comment?

PPN071A01-T7 PPN Prunus persica cDNA clone PPN071A01, mRNA sequence

DNA Sequence

GCTCCAGGTCCATCTCCAGCACCAAAGCACAAGAAGCATAAGAACAACAAGAAGAAGCTAGGAGGGTGGCTGCTCGGATTTTTCGCTGGAGCTCTGGCTGGGAGCATATCCGGGTTCATCTTCTCTCTGCTTTTTAAGCTGCTCTTAGCTGTGGTAAGAGGTGGAGGCAAAGACTCAGGCCCAGCAATTTTCAGTTCTCTGATTAAAAGGAAGGAGGACTTGGCTTTCCTGGAAAAAGAAGATGGGTTGGCTTCTCTGGAACTTATAGGAAGAGGTGGATGTGGAGAGGTTTATAAAGCTGAATTACCTGGAAGCAATGGCAGAATGATTGCTATAAAGAAGATTATTCAACCCCCTAAAGATGCTGAAGAGCTGACTGCTGATGAAGACAGTAAGCTGATGAACAAGAAAATGCGCCAAATCCGATCAGAAATCAACACTGTGGGTCAAATTAGGCACCGAAATCTTCTTCCTCTGTTGGCTCATGTGTCTCGACCGGATTGTCATTACCTGATCTATGAGTTCATGAAGAATGGAAGCTTGCAAGACATATTGAATCAAGTGTCGGAGGGAACGAGAGAGTTGGATTGGCTTACTAGGCACAAGATTGCACTGGGAGTGGCTGCAGGGCTTGAATACCTTCACATGAACCACAAACCTCACATCATTCATAGAGATCTCAAAGCCAGCAATGTCCTGCTTGATGATGATATGGAAGCTCGAATTGCAGATTTTGGGCTTGCAAA


Protein sequences

Name Description Sequence
Ppe.13525 translated coding region predicted by ESTScan from UniGene Ppe.13525

APGPSPAPKHKKHKNNKKKLGGWLLGFFAGALAGSISGFIFSLLFKLLLAVVRGGGKDSGPAIFSSLIKRKEDLAFLEKEDGLASLELIGRGGCGEVYKAELPGSNGRMIAIKKIIQPPKDAEELTADEDSKLMNKKMRQIRSEINTVGQIRHRNLLPLLAHVSRPDCHYLIYEFMKNGSLQDILNQVSEGTRELDWLTRHKIALGVAAGLEYLHMNHKPHIIHRDLKASNVLLDDDMEARIADFGLAX

Domains

Domain Start-End Description Sequence

Seg: seg
2-35 seg

PGPSPAPKHKKHKNNKKKLGGWLLGFFAGALAGS

HMMPanther: PTHR24420:SF83
4-248 SUBFAMILY NOT NAMED,SUBFAMILY NOT NAMED

PSPAPKHKKHKNNKKKLGGWLLGFFAGALAGSISGFIFSLLFKLLLAVVRGGGKDSGPAIFSSLIKRKEDLAFLEKEDGLASLELIGRGGCGEVYKAELPGSNGRMIAIKKIIQPPKDAEELTADEDSKLMNKKMRQIRSEINTVGQIRHRNLLPLLAHVSRPDCHYLIYEFMKNGSLQDILNQVSEGTRELDWLTRHKIALGVAAGLEYLHMNHKPHIIHRDLKASNVLLDDDMEARIADFGLA

HMMPanther: PTHR24420
4-248 FAMILY NOT NAMED,FAMILY NOT NAMED

PSPAPKHKKHKNNKKKLGGWLLGFFAGALAGSISGFIFSLLFKLLLAVVRGGGKDSGPAIFSSLIKRKEDLAFLEKEDGLASLELIGRGGCGEVYKAELPGSNGRMIAIKKIIQPPKDAEELTADEDSKLMNKKMRQIRSEINTVGQIRHRNLLPLLAHVSRPDCHYLIYEFMKNGSLQDILNQVSEGTRELDWLTRHKIALGVAAGLEYLHMNHKPHIIHRDLKASNVLLDDDMEARIADFGLA

superfamily: SSF56112
IPR011009
53-248 Protein kinase-like (PK-like)
Protein kinase-like domain

RGGGKDSGPAIFSSLIKRKEDLAFLEKEDGLASLELIGRGGCGEVYKAELPGSNGRMIAIKKIIQPPKDAEELTADEDSKLMNKKMRQIRSEINTVGQIRHRNLLPLLAHVSRPDCHYLIYEFMKNGSLQDILNQVSEGTRELDWLTRHKIALGVAAGLEYLHMNHKPHIIHRDLKASNVLLDDDMEARIADFGLA

Gene3D: G3DSA:3.30.200.20
80-162 no description

EDGLASLELIGRGGCGEVYKAELPGSNGRMIAIKKIIQPPKDAEELTADEDSKLMNKKMRQIRSEINTVGQIRHRNLLPLLAH

ProfileScan: PS50011
IPR000719
83-249 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

LASLELIGRGGCGEVYKAELPGSNGRMIAIKKIIQPPKDAEELTADEDSKLMNKKMRQIRSEINTVGQIRHRNLLPLLAHVSRPDCHYLIYEFMKNGSLQDILNQVSEGTRELDWLTRHKIALGVAAGLEYLHMNHKPHIIHRDLKASNVLLDDDMEARIADFGLAX

HMMSmart: SM00219
IPR020635
83-249 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

LASLELIGRGGCGEVYKAELPGSNGRMIAIKKIIQPPKDAEELTADEDSKLMNKKMRQIRSEINTVGQIRHRNLLPLLAHVSRPDCHYLIYEFMKNGSLQDILNQVSEGTRELDWLTRHKIALGVAAGLEYLHMNHKPHIIHRDLKASNVLLDDDMEARIADFGLAX

HMMSmart: SM00220
IPR002290
83-249 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

LASLELIGRGGCGEVYKAELPGSNGRMIAIKKIIQPPKDAEELTADEDSKLMNKKMRQIRSEINTVGQIRHRNLLPLLAHVSRPDCHYLIYEFMKNGSLQDILNQVSEGTRELDWLTRHKIALGVAAGLEYLHMNHKPHIIHRDLKASNVLLDDDMEARIADFGLAX

HMMPfam: PF00069
IPR017442
86-248 Pkinase,Ser-thr
Serine/threonine-protein kinase-like domain

LELIGRGGCGEVYKAELPGSNGRMIAIKKIIQPPKDAEELTADEDSKLMNKKMRQIRSEINTVGQIRHRNLLPLLAHVSRPDCHYLIYEFMKNGSLQDILNQVSEGTRELDWLTRHKIALGVAAGLEYLHMNHKPHIIHRDLKASNVLLDDDMEARIADFGLA

Gene3D: G3DSA:1.10.510.10
163-248 no description

VSRPDCHYLIYEFMKNGSLQDILNQVSEGTRELDWLTRHKIALGVAAGLEYLHMNHKPHIIHRDLKASNVLLDDDMEARIADFGLA

PatternScan: PS00108
IPR008271
222-234 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

IIHRDLKASNVLL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox