PRGDB00074312 (Ppe.13568)

From PRG Wiki
Jump to: navigation, search
Ppe.13568
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 89478893 (DY634687)
Gene Class Unknown
Domain Type LRR
Gene Species Prunus persica

Comment?

PU1_plate30_D15 PU1 Prunus persica cDNA similar to weakly similar to leucine-rich repeat transmembrane protein kinase [ A. thaliana ], mRNA sequence

DNA Sequence

CTTTGAAGCTCCATTCCCAAAAGTCTATCCTCCCGTCAACCCCAAGACATGTCGTCATTGACAAACCGGGAAAACCATCTCCGCCTCTATCTCCTCTTTGTCCTCTGCCTTCTCTCCAACACAAAAGCCGCCGCGGTGGACGAGCTTCAAATTCTCTTGAAACTCAAATCCACATTCCAAAACTCAAACACCAACAGCAGCATATTCAGCACATGGAACTCCTCCAATCCCCTGTGCAGTTTCAGCGGAATTGTCTGCAATGAAAAGAATTCAGTTCGAGAAATCGAGCTTTCGAATGGGAACCTTTCTGGGTTTCTTGCGCTGGACGAAATATGCCAGCTCCAATCCTTGGAAAAACTAGCTTTGGGATTCAACTCTTTGAATGGCACGATCAAGGAGGACTTGAACAACTGCACAAAATTGAAGTACTTGGATTTGGGAAACAATTTGTTCACAGGATCGTTCCCTGAGATATCATCCTTGTCCGAATTACAACATCTTCATCTGAACCACAGCGGAATTTCGGGTACTTTTCCATGGAAATCATTGAACAACATGACGGGTCTGATTCGGTTGAGCTTGGGAGACAACACTTTTGATTCAAGCTCCTTTCCAAGCGAATCTTCAACCTCAAGAATCTCACCT


Protein sequences

Name Description Sequence
Ppe.13568 translated coding region predicted by ESTScan from UniGene Ppe.13568

MSSLTNRENHLRLYLLFVLCLLSNTKAAAVDELQILLKLKSTFQNSNTNSSIFSTWNSSNPLCSFSGIVCNEKNSVREIELSNGNLSGFLALDEICQLQSLEKLALGFNSLNGTIKEDLNNCTKLKYLDLGNNLFTGSFPEISSLSELQHLHLNHSGISGTFPWKSLNNMTGLIRLSLGDNTFDSSSFPSESSTSRISP


Domains

Domain Start-End Description Sequence

Seg: seg
11-22 seg

LRLYLLFVLCLL

HMMPanther: PTHR24420
13-183 FAMILY NOT NAMED,FAMILY NOT NAMED

LYLLFVLCLLSNTKAAAVDELQILLKLKSTFQNSNTNSSIFSTWNSSNPLCSFSGIVCNEKNSVREIELSNGNLSGFLALDEICQLQSLEKLALGFNSLNGTIKEDLNNCTKLKYLDLGNNLFTGSFPEISSLSELQHLHLNHSGISGTFPWKSLNNMTGLIRLSLGDNTF

superfamily: SSF52058
26-185 L domain-like,LRR

KAAAVDELQILLKLKSTFQNSNTNSSIFSTWNSSNPLCSFSGIVCNEKNSVREIELSNGNLSGFLALDEICQLQSLEKLALGFNSLNGTIKEDLNNCTKLKYLDLGNNLFTGSFPEISSLSELQHLHLNHSGISGTFPWKSLNNMTGLIRLSLGDNTFDS

HMMPfam: PF08263
IPR013210
31-71 LRRNT_2
Leucine-rich repeat-containing N-terminal, type 2

DELQILLKLKSTFQNSNTNSSIFSTWNSSNPLCSFSGIVCN

Gene3D: G3DSA:3.80.10.10
31-188 no description

DELQILLKLKSTFQNSNTNSSIFSTWNSSNPLCSFSGIVCNEKNSVREIELSNGNLSGFLALDEICQLQSLEKLALGFNSLNGTIKEDLNNCTKLKYLDLGNNLFTGSFPEISSLSELQHLHLNHSGISGTFPWKSLNNMTGLIRLSLGDNTFDSSSF

ProfileScan: PS51450
IPR001611
100-123 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

SLEKLALGFNSLNGTIKEDLNNCT

ProfileScan: PS51450
IPR001611
124-146 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

KLKYLDLGNNLFTGSFPEISSLS

Seg: seg
185-198 seg

SSSFPSESSTSRIS






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox