PRGDB00074315 (Ppe.16207)

From PRG Wiki
Jump to: navigation, search
Ppe.16207
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 209176285 (FC862792)
Gene Class Unknown
Domain Type
Gene Species Prunus persica

Comment?

PPN034D04-T7 PPN Prunus persica cDNA clone PPN034D04, mRNA sequence

DNA Sequence

GATTATTGAACAGATTCATGTGCTGAGCAAAGAAATGGTTGGCATTGGCATGCTTCTGTCGAATTACCTCCCACTGAAAATAGTGGACAAGTTTGTGTCACTGCTTGCCAAGTTGAGCTACAGTGATTTGTCCAGCTATGGCATTCATCGCCCAGTTGAAGGGCCATTTCTCTTTAAAGCCCTTACCGGAAAGACTCCAGTAATTGATCGTGGAACCATCAAGAAAATTCGCTCCAAAAAGATTCAGGTTTTTCCAGATGTAGTGAGTATAAACCAGAACACTGTGGAATTCAAAGATGGTAAACGACGGTGTTTTGATGCTATTGTGTTGGCAACTGGTTACAGAAGCGTAGCACATAAATGGTTGAAGGACTACAAGTTCCCTCTTACAGATGATGGAAAGCCTAAAGGGAAGTACCCAAACCACTGGAAGGGCGAGAAAGGTGTCTATTGTGTTGGATTAACAGGGAAGGGACTGCCAGGGATTTTCAAAGATTCAAAGGCTGTAACTGAAGACATCTATCGACTTACATTAATGGCACAAAAGTAATTGATGTGCATTCCATGGGCACTAGTATTGCACGTATGCAGACACGGGCTAGCTTGTACCATACTATTATCCTACCTATAATGTGTATTTGTGTGTTGAATAAGACAAATCACTGTGTGTGGATTCCGAGTCTTTGCGTTTATAATTGGTGCATTTTCCCGCATGTCATTTTGNTCGTCGTGTTTTTGACACTATGATGCCCATG


Protein sequences

Name Description Sequence
Ppe.16207 translated coding region predicted by ESTScan from UniGene Ppe.16207

XIIEQIHVLSKEMVGIGMLLSNYLPLKIVDKFVSLLAKLSYSDLSSYGIHRPVEGPFLFKALTGKTPVIDRGTIKKIRSKKIQVFPDVVSINQNTVEFKDGKRRCFDAIVLATGYRSVAHKWLKDYKFPLTDDGKPKGKYPNHWKGEKGVYCVGLTGKGLPGIFKDSKAVTEDIYRLTLMAQK

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR23023:SF5
4-174 MONOOXYGENASE,MONOOXYGENASE

EQIHVLSKEMVGIGMLLSNYLPLKIVDKFVSLLAKLSYSDLSSYGIHRPVEGPFLFKALTGKTPVIDRGTIKKIRSKKIQVFPDVVSINQNTVEFKDGKRRCFDAIVLATGYRSVAHKWLKDYKFPLTDDGKPKGKYPNHWKGEKGVYCVGLTGKGLPGIFKDSKAVTEDI

HMMPanther: PTHR23023
4-174 FAMILY NOT NAMED,DIMETHYLANILINE MONOOXYGENASE

EQIHVLSKEMVGIGMLLSNYLPLKIVDKFVSLLAKLSYSDLSSYGIHRPVEGPFLFKALTGKTPVIDRGTIKKIRSKKIQVFPDVVSINQNTVEFKDGKRRCFDAIVLATGYRSVAHKWLKDYKFPLTDDGKPKGKYPNHWKGEKGVYCVGLTGKGLPGIFKDSKAVTEDI

Gene3D: G3DSA:3.50.50.60
36-175 no description

LAKLSYSDLSSYGIHRPVEGPFLFKALTGKTPVIDRGTIKKIRSKKIQVFPDVVSINQNTVEFKDGKRRCFDAIVLATGYRSVAHKWLKDYKFPLTDDGKPKGKYPNHWKGEKGVYCVGLTGKGLPGIFKDSKAVTEDIY

superfamily: SSF51905
47-154 FAD/NAD(P)-binding domain

YGIHRPVEGPFLFKALTGKTPVIDRGTIKKIRSKKIQVFPDVVSINQNTVEFKDGKRRCFDAIVLATGYRSVAHKWLKDYKFPLTDDGKPKGKYPNHWKGEKGVYCVG






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox