PRGDB00074316 (Ppe.16886)

From PRG Wiki
Jump to: navigation, search
Ppe.16886
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 89491045 (DY646839)
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Prunus persica

Comment?

PU3_plate31_M13 PU3 Prunus persica cDNA similar to weakly similar to leucine-rich repeat transmembrane protein kinase, putative [Arabidopsis thaliana] contains InterProScan IPR002114: HPr serine phosphorylation site, IPR006662: Thioredoxin-related, mRN>

DNA Sequence

CtttttttttttttttATGGGCAAAATTGAGGGGATTCTTTAGCATAATGAATCATGTTTGTTTACAAGAAGAATTACATAAATAAAATTTGAGTATGAAATTAAATTACTTTGCAAACTATGTAATGCTTTTTTGACAGAAACTAGAATTTAAAATCAAAATGGAGGAGGGGAACCATAATTGAAATCCCCTTGGGTGCTGGATATCTTGATTAGCATAGCTAACACCTCCTTCATGTTTGGTCTTGACTGTGGTGCCTCGGCTGTGCACTTTATGCCAACCTTAAGCAGCTCACACATCTCCTCTGCCCCATCAAGAAGCCCAGACCCCATAAGCATAACTGGTATCACAGATCTATTGAATCCGGGCCGTCCATTTCCCATTACCCTTCTTGCCCATTCTACAAGGCACTCCTCTCCTCCATCCACTGCCCTCCTCCCAGTTGCCAACTCCATTGCCAGCACTCCATAACTGTACACATCCCCTTTTGTTGTGGCTTGCCATGTCTGCCCATATTCTGGTGCAACATAACCAACTGTCCCTGCCACCATTGTGCTCACATGACTATCCCCCGCATCACTATTCTTGCCACCCAAAACTGTAACTCT


Protein sequences

Name Description Sequence
Ppe.16886 translated coding region predicted by ESTScan from UniGene Ppe.16886

RVTVLGGKNSDAGDSHVSTMVAGTVGYVAPEYGQTWQATTKGDVYSYGVLAMELATGRRAVDGGEECLVEWARRVMGNGRPGFNRSVIPVMLMGSGLLDGAEEMCELLKVGIKCTAEAPQSRPNMKEVLAMLIKISSTQGDFNYGSPPPF

Domains

Domain Start-End Description Sequence

ProfileScan: PS50011
IPR000719
1-135 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

RVTVLGGKNSDAGDSHVSTMVAGTVGYVAPEYGQTWQATTKGDVYSYGVLAMELATGRRAVDGGEECLVEWARRVMGNGRPGFNRSVIPVMLMGSGLLDGAEEMCELLKVGIKCTAEAPQSRPNMKEVLAMLIKI

HMMPanther: PTHR24420:SF117
13-136 SUBFAMILY NOT NAMED,SUBFAMILY NOT NAMED

GDSHVSTMVAGTVGYVAPEYGQTWQATTKGDVYSYGVLAMELATGRRAVDGGEECLVEWARRVMGNGRPGFNRSVIPVMLMGSGLLDGAEEMCELLKVGIKCTAEAPQSRPNMKEVLAMLIKIS

HMMPanther: PTHR24420
13-136 FAMILY NOT NAMED,FAMILY NOT NAMED

GDSHVSTMVAGTVGYVAPEYGQTWQATTKGDVYSYGVLAMELATGRRAVDGGEECLVEWARRVMGNGRPGFNRSVIPVMLMGSGLLDGAEEMCELLKVGIKCTAEAPQSRPNMKEVLAMLIKIS

HMMPfam: PF00069
IPR017442
15-130 Pkinase,Ser-thr
Serine/threonine-protein kinase-like domain

SHVSTMVAGTVGYVAPEYGQTWQATTKGDVYSYGVLAMELATGRRAVDGGEECLVEWARRVMGNGRPGFNRSVIPVMLMGSGLLDGAEEMCELLKVGIKCTAEAPQSRPNMKEVLA

superfamily: SSF56112
IPR011009
16-132 Protein kinase-like (PK-like)
Protein kinase-like domain

HVSTMVAGTVGYVAPEYGQTWQATTKGDVYSYGVLAMELATGRRAVDGGEECLVEWARRVMGNGRPGFNRSVIPVMLMGSGLLDGAEEMCELLKVGIKCTAEAPQSRPNMKEVLAML

Gene3D: G3DSA:1.10.510.10
16-134 no description

HVSTMVAGTVGYVAPEYGQTWQATTKGDVYSYGVLAMELATGRRAVDGGEECLVEWARRVMGNGRPGFNRSVIPVMLMGSGLLDGAEEMCELLKVGIKCTAEAPQSRPNMKEVLAMLIK






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox