PRGDB00074317 (Ppe.16901)

From PRG Wiki
Jump to: navigation, search
Ppe.16901
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 209177698 (FC861447)
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Prunus persica

Comment?

PPN070E07-T7 PPN Prunus persica cDNA clone PPN070E07, mRNA sequence

DNA Sequence

AGTCCAACAGTGGTGGAACAGAAAACTCTCATATGATTGAGGCTGGGAACCTTGTCATTTCTGTTCAAGTTCTTCGAAAGGTGACCAAAAATTTTGCACCCGAAAATGAGCTAGGCCGTGGCGGATTTGGAACTGTTTACAAGGGTGAACTAGAAGATGGGACACAATTAGCTGTTAAGAGAATGGAGGGTGGGGTAATCAGTAGCAAAGCATTGGATGAATTTGAGGCAGAAATTGCTGTTCTATCCAAGGTCCGTCATCGGCACTTGGTTTCTCTTTTGGGGTACTCCATCGAAGGCAATGAAAGGCTTCTTGTCTACGAGTATTTGTCTCAAGGTGCTCTTAGCCGGCATCTTTTCCATTGGAAGAGCCTCAACCTGAAACCTTTGTCTTGGACAAGGAGACTCACAATTGTATTGGATGTTGCAAGAGCAATGGAGTACCTACATAATTTAGCCCGCCAGACCTTCATACACCGAGATCTCAAATCCTCTAATATTCTTCTGGATGATAACTTTCATGCAAAAGTTTCGGATTTTGGGTTGGTGAAACTTGCTCCTGATGGAGAGAAGTCTATTGCCACTAAGCTTGCAGGGACATTTGGATACCTTGCACCTGAATATGCAGTAATGGGGAAAATCACAAACAAGGTAGATGTGTTCAGCTTTGGGGTGGTGCTAATGGAACTTTTGACTGGATTAATGGCACTTGATG


Protein sequences

Name Description Sequence
Ppe.16901 translated coding region predicted by ESTScan from UniGene Ppe.16901

XSNSGGTENSHMIEAGNLVISVQVLRKVTKNFAPENELGRGGFGTVYKGELEDGTQLAVKRMEGGVISSKALDEFEAEIAVLSKVRHRHLVSLLGYSIEGNERLLVYEYLSQGALSRHLFHWKSLNLKPLSWTRRLTIVLDVARAMEYLHNLARQTFIHRDLKSSNILLDDNFHAKVSDFGLVKLAPDGEKSIATKLAGTFGYLAPEYAVMGKITNKVDVFSFGVVLMELLTGLMALDX

Domains

Domain Start-End Description Sequence

superfamily: SSF56112
IPR011009
4-238 Protein kinase-like (PK-like)
Protein kinase-like domain

SGGTENSHMIEAGNLVISVQVLRKVTKNFAPENELGRGGFGTVYKGELEDGTQLAVKRMEGGVISSKALDEFEAEIAVLSKVRHRHLVSLLGYSIEGNERLLVYEYLSQGALSRHLFHWKSLNLKPLSWTRRLTIVLDVARAMEYLHNLARQTFIHRDLKSSNILLDDNFHAKVSDFGLVKLAPDGEKSIATKLAGTFGYLAPEYAVMGKITNKVDVFSFGVVLMELLTGLMALD

HMMPanther: PTHR24420:SF467
8-238 SUBFAMILY NOT NAMED,SUBFAMILY NOT NAMED

ENSHMIEAGNLVISVQVLRKVTKNFAPENELGRGGFGTVYKGELEDGTQLAVKRMEGGVISSKALDEFEAEIAVLSKVRHRHLVSLLGYSIEGNERLLVYEYLSQGALSRHLFHWKSLNLKPLSWTRRLTIVLDVARAMEYLHNLARQTFIHRDLKSSNILLDDNFHAKVSDFGLVKLAPDGEKSIATKLAGTFGYLAPEYAVMGKITNKVDVFSFGVVLMELLTGLMALD

HMMPanther: PTHR24420
8-238 FAMILY NOT NAMED,FAMILY NOT NAMED

ENSHMIEAGNLVISVQVLRKVTKNFAPENELGRGGFGTVYKGELEDGTQLAVKRMEGGVISSKALDEFEAEIAVLSKVRHRHLVSLLGYSIEGNERLLVYEYLSQGALSRHLFHWKSLNLKPLSWTRRLTIVLDVARAMEYLHNLARQTFIHRDLKSSNILLDDNFHAKVSDFGLVKLAPDGEKSIATKLAGTFGYLAPEYAVMGKITNKVDVFSFGVVLMELLTGLMALD

Gene3D: G3DSA:3.30.200.20
17-95 no description

NLVISVQVLRKVTKNFAPENELGRGGFGTVYKGELEDGTQLAVKRMEGGVISSKALDEFEAEIAVLSKVRHRHLVSLLG

ProfileScan: PS50011
IPR000719
32-239 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

FAPENELGRGGFGTVYKGELEDGTQLAVKRMEGGVISSKALDEFEAEIAVLSKVRHRHLVSLLGYSIEGNERLLVYEYLSQGALSRHLFHWKSLNLKPLSWTRRLTIVLDVARAMEYLHNLARQTFIHRDLKSSNILLDDNFHAKVSDFGLVKLAPDGEKSIATKLAGTFGYLAPEYAVMGKITNKVDVFSFGVVLMELLTGLMALDX

HMMSmart: SM00219
IPR020635
32-239 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

FAPENELGRGGFGTVYKGELEDGTQLAVKRMEGGVISSKALDEFEAEIAVLSKVRHRHLVSLLGYSIEGNERLLVYEYLSQGALSRHLFHWKSLNLKPLSWTRRLTIVLDVARAMEYLHNLARQTFIHRDLKSSNILLDDNFHAKVSDFGLVKLAPDGEKSIATKLAGTFGYLAPEYAVMGKITNKVDVFSFGVVLMELLTGLMALDX

HMMSmart: SM00220
IPR002290
32-238 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

FAPENELGRGGFGTVYKGELEDGTQLAVKRMEGGVISSKALDEFEAEIAVLSKVRHRHLVSLLGYSIEGNERLLVYEYLSQGALSRHLFHWKSLNLKPLSWTRRLTIVLDVARAMEYLHNLARQTFIHRDLKSSNILLDDNFHAKVSDFGLVKLAPDGEKSIATKLAGTFGYLAPEYAVMGKITNKVDVFSFGVVLMELLTGLMALD

HMMPfam: PF00069
IPR017442
36-234 Pkinase,Ser-thr
Serine/threonine-protein kinase-like domain

NELGRGGFGTVYKGELEDGTQLAVKRMEGGVISSKALDEFEAEIAVLSKVRHRHLVSLLGYSIEGNERLLVYEYLSQGALSRHLFHWKSLNLKPLSWTRRLTIVLDVARAMEYLHNLARQTFIHRDLKSSNILLDDNFHAKVSDFGLVKLAPDGEKSIATKLAGTFGYLAPEYAVMGKITNKVDVFSFGVVLMELLTGL

PatternScan: PS00107
IPR017441
38-60 PROTEIN_KINASE_ATP
Protein kinase, ATP binding site

LGRGGFGTVYKGELEDGTQLAVK

Gene3D: G3DSA:1.10.510.10
96-234 no description

YSIEGNERLLVYEYLSQGALSRHLFHWKSLNLKPLSWTRRLTIVLDVARAMEYLHNLARQTFIHRDLKSSNILLDDNFHAKVSDFGLVKLAPDGEKSIATKLAGTFGYLAPEYAVMGKITNKVDVFSFGVVLMELLTGL

PatternScan: PS00108
IPR008271
157-169 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

FIHRDLKSSNILL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox