PRGDB00074318 (Ppe.17398)

From PRG Wiki
Jump to: navigation, search
Ppe.17398
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 89492497 (DY648291)
Gene Class Unknown
Domain Type LRR
Gene Species Prunus persica

Comment?

PU4_plate7_F12 PU4 Prunus persica cDNA similar to weakly similar to receptor-like protein kinase [Nicotiana tabacum], mRNA sequence

DNA Sequence

ATTAGTTCAAACTTCAAACACAGCTTTTCCGGCCAAAAAATGGAAGCCTTCTCAGGCAAAGCCCACCTCTGCGtcctcaccttcctttccctcctcctcctcATCCATGCAAGGCTCAATCTCGACCCTTCAGATCTCCAAGCCCTCTCCATCATCCAAAAAAACTTGGGCCTCCAAATAAGTAAACCTCAAACAACACCATGCAACACCCCTGGTGTTTTCTGTGAGCGAAGGCTCTCAAACAACAACACTTACGTCCTCAAAATCACCAGGCTGGTCTTTCAATCCCAGCGGCTTCACGGGTTTCTGCCTCCGGCAATTGGGCGGCTCTCCGAGCTCAAAGAGATAGCTCTTGCAGACAACAGCCTTGTTGACCAAATCCCGTCTCAAATCGTTGACTGCCGGAAACTTGAGATTCTCAACCTCAGAAACAACCAGTTCTCCGGGGAAGTTCCAGCCCAGTTGTCCAAGCTCGTTCGCCTTCGAATCCTCGACCTCTCGTCCAACAAGTTTTCCGGGAACTTGAGTTTCCTCAAGCTTTTTCCCAACCTGGAAAAACTTTCCATTGCTGACNATTTCTTCTCTGGCAAAACCCAGCTTCCAT


Protein sequences

Name Description Sequence
Ppe.17398 translated coding region predicted by ESTScan from UniGene Ppe.17398

MEAFSGKAHLCVLTFLSLLLLIHARLNLDPSDLQALSIIQKNLGLQISKPQTTPCNTPGVFCERRLSNNNTYVLKITRLVFQSQRLHGFLPPAIGRLSELKEIALADNSLVDQIPSQIVDCRKLEILNLRNNQFSGEVPAQLSKLVRLRILDLSSNKFSGNLSFLKLFPNLEKLSIADXFFSGKTQLPX

Domains

Domain Start-End Description Sequence

Seg: seg
10-21 seg

LCVLTFLSLLLL

HMMPanther: PTHR24420:SF83
10-184 SUBFAMILY NOT NAMED,SUBFAMILY NOT NAMED

LCVLTFLSLLLLIHARLNLDPSDLQALSIIQKNLGLQISKPQTTPCNTPGVFCERRLSNNNTYVLKITRLVFQSQRLHGFLPPAIGRLSELKEIALADNSLVDQIPSQIVDCRKLEILNLRNNQFSGEVPAQLSKLVRLRILDLSSNKFSGNLSFLKLFPNLEKLSIADXFFSGK

HMMPanther: PTHR24420
10-184 FAMILY NOT NAMED,FAMILY NOT NAMED

LCVLTFLSLLLLIHARLNLDPSDLQALSIIQKNLGLQISKPQTTPCNTPGVFCERRLSNNNTYVLKITRLVFQSQRLHGFLPPAIGRLSELKEIALADNSLVDQIPSQIVDCRKLEILNLRNNQFSGEVPAQLSKLVRLRILDLSSNKFSGNLSFLKLFPNLEKLSIADXFFSGK

superfamily: SSF52058
26-184 L domain-like,LRR

LNLDPSDLQALSIIQKNLGLQISKPQTTPCNTPGVFCERRLSNNNTYVLKITRLVFQSQRLHGFLPPAIGRLSELKEIALADNSLVDQIPSQIVDCRKLEILNLRNNQFSGEVPAQLSKLVRLRILDLSSNKFSGNLSFLKLFPNLEKLSIADXFFSGK

Gene3D: G3DSA:3.80.10.10
46-183 no description

QISKPQTTPCNTPGVFCERRLSNNNTYVLKITRLVFQSQRLHGFLPPAIGRLSELKEIALADNSLVDQIPSQIVDCRKLEILNLRNNQFSGEVPAQLSKLVRLRILDLSSNKFSGNLSFLKLFPNLEKLSIADXFFSG

HMMPfam: PF12799
123-166 LRR_4,Leucine Rich repeats (2 copies)

KLEILNLRNNQFSGEVPAQLSKLVRLRILDLSSNKFSGNLSFLK






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox