PRGDB00074319 (Ppe.18451)

From PRG Wiki
Jump to: navigation, search
Ppe.18451
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 115594674 (AM289705)
Gene Class Unknown
Domain Type LRR
Gene Species Prunus persica

Comment?

AM289705 Prunus persica fruit skin mature fruit Prunus persica cDNA clone Skin13E07, mRNA sequence

DNA Sequence

GAGGAAATGAACATTGACTATGGCCATGATTTGGTGGAATTGCCTGCCGAGCTCTGTGGTCTTAGTCAACTAAAGAAGCTCAGTGTCACCAATTGTCATAAGCTATCTGCCTTGCCTGAAGAGATTGGAAAGTTGACCAAGTTAGAAGTGTTGAGGCTAAAATCCTGTACAGACCTAGTAAAACTTCCAGGCTCGATGAAGAGCCTCAAAAAGTTAGACTTTCTTGACATATCTGATTGCTTCAGCATTAGGGAGTTGCCTGAAGACATTGGTGACATAAGCAATTTAAGAAAGATCAACATGAGACAGTGCTTAAGGTTGGAAGAGCTACCTCTATCTGTTTTGGATCTTGAGCAGTTAAAGGAAGTGATCTGTGATGAAGAGACAAAATATTTATGGGAATCTTTCTCATCTCACCTGAACAACGTAAGCATAAATGTGGCCAAAGAAAATATCAATCTTAATTGGCTCCACCACACTCAAATCTGACACCTGTAGTTTCTCAATGATTGTCTGCAACCTATGTGTGATTTGTCTTTCATTGTTTTCCTATTTTCCCTGTAtttttttttcaatgttttccttctgtttttGTAAATAGAATGAGATATTGCAGGTAAAATAATGAATATTGTCAAATTTAGGGATTGAATaaaaaaaaa


Protein sequences

Name Description Sequence
Ppe.18451 translated coding region predicted by ESTScan from UniGene Ppe.18451

EEMNIDYGHDLVELPAELCGLSQLKKLSVTNCHKLSALPEEIGKLTKLEVLRLKSCTDLVKLPGSMKSLKKLDFLDISDCFSIRELPEDIGDISNLRKINMRQCLRLEELPLSVLDLEQLKEVICDEETKYLWESFSSHLNNVSINVAKENINLNWLHHTQI

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR23155:SF282
2-127 SUBFAMILY NOT NAMED,SUBFAMILY NOT NAMED

EMNIDYGHDLVELPAELCGLSQLKKLSVTNCHKLSALPEEIGKLTKLEVLRLKSCTDLVKLPGSMKSLKKLDFLDISDCFSIRELPEDIGDISNLRKINMRQCLRLEELPLSVLDLEQLKEVICDE

HMMPanther: PTHR23155
2-127 FAMILY NOT NAMED,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

EMNIDYGHDLVELPAELCGLSQLKKLSVTNCHKLSALPEEIGKLTKLEVLRLKSCTDLVKLPGSMKSLKKLDFLDISDCFSIRELPEDIGDISNLRKINMRQCLRLEELPLSVLDLEQLKEVICDE

Gene3D: G3DSA:3.80.10.10
13-122 no description

ELPAELCGLSQLKKLSVTNCHKLSALPEEIGKLTKLEVLRLKSCTDLVKLPGSMKSLKKLDFLDISDCFSIRELPEDIGDISNLRKINMRQCLRLEELPLSVLDLEQLKE

superfamily: SSF52058
15-123 L domain-like,LRR

PAELCGLSQLKKLSVTNCHKLSALPEEIGKLTKLEVLRLKSCTDLVKLPGSMKSLKKLDFLDISDCFSIRELPEDIGDISNLRKINMRQCLRLEELPLSVLDLEQLKEV

HMMPfam: PF13855
22-80 LRR_8,Leucine rich repeat

SQLKKLSVTNCHKLSALPEEIGKLTKLEVLRLKSCTDLVKLPGSMKSLKKLDFLDISDC






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox