PRGDB00074321 (Ppe.18950)

From PRG Wiki
Jump to: navigation, search
Ppe.18950
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 115594828 (AM289723)
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Prunus persica

Comment?

AM289723 Prunus persica fruit skin mature fruit Prunus persica cDNA clone Skin13G02, mRNA sequence

DNA Sequence

TCCATCGTGATATTAAGTCCTGCAATATACTGCTTTTTGATGATGATGTTGCAAAGATTGCTGACTTTGATCTGTCCAATCAAGCCCCTGATATGGCTGCACGTCTTCATTCCACTCGTGTTCTTGGGACTTTTGGTTATCATGCTCCAGAATATGCAATGACCGGACAGCTGAGTTCAAAAAGTGATGTTTACAGCTTTGGTGTAGTTCTGCTTGAACTCTTGACTGGGCGCAAACCTGTTGATCACACATTGCCACGTGGACAGCAGAGCCTTGTGACATGGGCAACACCGAAACTCAGTGAAGATAAGGTGAAGCAGTGTGTTGATGCTAGACTCAATGGAGAATACCCTTCCAAGGCAGTTGCAAAGCTGGCTGCTGTTGCTGCCTTGTGCGTCCAATATGAAGCTGATTTTCGGCCAAATATGAGCATTGTCGTCAAGGCTCTACAGCCGCTATTGAATGCTCGGTCCGGCCCCCACCATTGAAACAAAAAACGCTTGGCTTCGCGACCTGTCAATCTCTCTTGCAGACAATATTGTTGAAGATTCATTTGGTAAACATAGTTGTGTAGATCATGTAACATCCTCTGGTTCCCTTGAGTCATCAAAATCTTACTGATCCTATATAGTTCACATTGATTCTGCTACCGGTTTAAAAGTTGCTTaaaaaaaaaaaaaaaaaaaa


Protein sequences

Name Description Sequence
Ppe.18950 translated coding region predicted by ESTScan from UniGene Ppe.18950

XHRDIKSCNILLFDDDVAKIADFDLSNQAPDMAARLHSTRVLGTFGYHAPEYAMTGQLSSKSDVYSFGVVLLELLTGRKPVDHTLPRGQQSLVTWATPKLSEDKVKQCVDARLNGEYPSKAVAKLAAVAALCVQYEADFRPNMSIVVKALQPLLNARSGPHH

Domains

Domain Start-End Description Sequence

ProfileScan: PS50011
IPR000719
1-154 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

XHRDIKSCNILLFDDDVAKIADFDLSNQAPDMAARLHSTRVLGTFGYHAPEYAMTGQLSSKSDVYSFGVVLLELLTGRKPVDHTLPRGQQSLVTWATPKLSEDKVKQCVDARLNGEYPSKAVAKLAAVAALCVQYEADFRPNMSIVVKALQPLL

HMMPfam: PF07714
IPR001245
2-150 Pkinase_Tyr
Serine-threonine/tyrosine-protein kinase

HRDIKSCNILLFDDDVAKIADFDLSNQAPDMAARLHSTRVLGTFGYHAPEYAMTGQLSSKSDVYSFGVVLLELLTGRKPVDHTLPRGQQSLVTWATPKLSEDKVKQCVDARLNGEYPSKAVAKLAAVAALCVQYEADFRPNMSIVVKAL

Gene3D: G3DSA:1.10.510.10
2-149 no description

HRDIKSCNILLFDDDVAKIADFDLSNQAPDMAARLHSTRVLGTFGYHAPEYAMTGQLSSKSDVYSFGVVLLELLTGRKPVDHTLPRGQQSLVTWATPKLSEDKVKQCVDARLNGEYPSKAVAKLAAVAALCVQYEADFRPNMSIVVKA

superfamily: SSF56112
IPR011009
2-150 Protein kinase-like (PK-like)
Protein kinase-like domain

HRDIKSCNILLFDDDVAKIADFDLSNQAPDMAARLHSTRVLGTFGYHAPEYAMTGQLSSKSDVYSFGVVLLELLTGRKPVDHTLPRGQQSLVTWATPKLSEDKVKQCVDARLNGEYPSKAVAKLAAVAALCVQYEADFRPNMSIVVKAL

HMMPanther: PTHR24420:SF870
2-160 SUBFAMILY NOT NAMED

HRDIKSCNILLFDDDVAKIADFDLSNQAPDMAARLHSTRVLGTFGYHAPEYAMTGQLSSKSDVYSFGVVLLELLTGRKPVDHTLPRGQQSLVTWATPKLSEDKVKQCVDARLNGEYPSKAVAKLAAVAALCVQYEADFRPNMSIVVKALQPLLNARSGP

HMMPanther: PTHR24420
2-160 FAMILY NOT NAMED,FAMILY NOT NAMED

HRDIKSCNILLFDDDVAKIADFDLSNQAPDMAARLHSTRVLGTFGYHAPEYAMTGQLSSKSDVYSFGVVLLELLTGRKPVDHTLPRGQQSLVTWATPKLSEDKVKQCVDARLNGEYPSKAVAKLAAVAALCVQYEADFRPNMSIVVKALQPLLNARSGP

Seg: seg
120-131 seg

KAVAKLAAVAAL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox