PRGDB00074323 (Ppe.19047)

From PRG Wiki
Jump to: navigation, search
Ppe.19047
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 237857404 (FJ982370)
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Prunus persica

Comment?

Prunus persica serine

DNA Sequence

ACGCGGGGCCGACAGTGGAAAATTGTAGAGAGAGAAACTCGACCTTCTCTGAAGTCCTCTGAGTCCTGTGACCTTTTTGTTTTCAACGATGGCGGGTTTAAGAGTTTCTAGGGTTTTGTGACGAATCGATTTCTCCAAAGTCTCGATGGAAATGCCCGGTAGGAGATCGAACTACACGCTTCTGAGCCAAGTCCCCGACGACCAGACGGCGGCGTTTTACGATTCGGAGAGCAAGAACAACAAAGGAAAAGCTGAGAGAGGATTCGAGTGGGAAACTGGAGCGGATTTTCGGGCGAATCGGGTCGGGAACCCGTACTCGTCAGTCGGGTTACAGAGGCAGTCGAGTGGGAGCAGCTTCGGTGAGAGCTCGCTCTCCGGTGAATACTACGCTCCGACTCTATCGAATACAGCGGCGAATGAGATCGATGGGTTCGGGTACGTGCCCGACGATGTGTTCAAGGTTGGTGGAGGTGGTGAATTTCGAATGAAAGGTGGGGATGGAGCTGTAGGGACCACCGGTGGCGGTGGCTCGTCTTCGGGGAAGAGCTGGGCTCAGCAGACTGAGGAGAGTTATCAGCTGCAGCTGGCTTTGGCTCTTCGGCTGTCGTCGGAGGCCACTTGTACCGATGATCCCAATTTCTTGGATCTAGTGCCGGATGTATCGTCATCGAGGTCGTCCGGCTCCGTTGACGCTGTTTCGCATCGGTTTTGGGTGAATGGCTGCCTATCGTACTTTGACATAGTGCCTGATGGATTTTACCTAATTCATGGAATAGATCCGTATGTATGGACTGTGTGCACTGATATGCAAGAGAATGGTCGTATACCATCAATTGAATCATTAAGGTCTGTTGATCCTGGCATTGGTTCTTCTATTGAAGTGGTTTTAATTGATCGACGTAGTGATCCCAGCTTAAAGGAACTCCAAAATAGGGTCTTCAGCCTTTCTTGTACTTGCATAACTACAAAAGAGATAGTAGATCAGCTGGCAAAACTTGTATGCAACCGCATGGGGGGTTCAGCTTCTGTAGGAGAGGATGAATTTGTCCCCATATGGAGGGAGAGCAGTGATGATCTGAAAGATTGCTTAGGATCTGTTGTTGTTCCAATAGGCAGCCTTTCTGTTGGTCTCTGTAGACATCGTGCTTTATTATTCAAAGTGCTAGCTGACAGAATTGATCTATCATGTCGAATTGCCAAAGGCTGTAAATATTGCACAAGAGATGATGCTTCCTCTTGTCTTGTCCGGTTTGGGCTTGACAGGGAGTATTTAGTAGATTTGATTGCAAATCCAGGTTACTTATGCGAGCCCGATTCCTTGCTCAATGGTCCATCATCCATCTCAATTTCTTCACCGCTGCGCTTTCCAAGACTAAAACCAGTTGAACCTACCATTGATTTCAGGTCACTGGCCAAACAGTATTTCTCGGACTGTCAATCGCTTAATCTTGTATTTGATGAAGCTTCTGCAGGAAGTGCTGTTGACGAGGACAATAAGGAATTCTCTATGTATCCTAAACAGTTAGATAGGAAGATTACAGAAGGAAACAACCTTTTACTAGTTTCAAGTCTCAATGACAACACTTCTATGTATGCAAAAGTTTCTCAGCCGAGTTTTGAAGATAGAAATCCCCAATTATTTAACCCTTCTCAAAACATTGTACACACACCAGGCATGGTAAAAGATCCAATCCCTCTAAAGCGTATACCACCCATAGGGCATAGAGATGTTTCAAGAGTGGATACAACTAAAGGCTCGAGGTTTGTCGAGGGAGTTCAACTGGTTCCTAGTAAACCAAGTAAAGAGCTCACATTCGATATAGAGGATTTGGACATCCCATGGAATGATCTTGTACTAAAAGATAGAATTGGTGCAGGTTCTTTTGGAACTGTTCATCGTGCCGATTGGCATGGCTCTGATGTTGCTGTGAAAATTCTTATGGAGCAAGACTTTCATGCCGAACGCTTTAAAGAATTTTTGAGAGAGGTTACTATAATGAAACGGCTGCGGCATCCAAATATTGTTCTCTTTATGGGTGCAGTTACGAAGCCCCCAAACTTGTCCATTGTGACAGAATATTTATCAAGAGGTAGCTTGTATAGGCTTTTGCATAAACCTGGCGCAATGGAGGCATTGGATGAGAAGCGCCGGTTGAATATGGCTTACGATGTGGCAAAAGGAATGAATTATCTTCATAGACGCAATCCTCCTATTGTTCATCGAGACTTAAAATCTCCAAATCTGTTGGTGGACAAAAAATATACAGTGAAGGTTTGTGACTTTGGTCTTTCCCGTTTAAAGGCAAACACTTTTCTCTCATCAAAGTCAGCTGCTGGGACTCCGGAATGGATGGCACCGGAAGTCCTGCGTGATGAACCGTCAAATGAGAAGTCAGATGTTTACAGTTTTGGTGTAATATTGTGGGAACTAGCTACACTGCAACAGCCGTGGGGTAATTTAAATCCAGCACAGGTTGTGGCAGCTGTTGGTTTTAAGAACAAAAGGCTTGAGATTCCACGTGATTTGAATCCTCAAGTGGCTTCGATCATTGAGGCTTGCTGGGCCAATGAGCCCTGGAAACGACCTTCATTTGCTAGTATCATGGAATCTTTGATGCCGTTGATTAAACCTCCGGCGACTCAACCTAGTCGTCCAGGCGTGCCATTACTCAGCTGAATGGGCGAATGCTTATTCATGCACATAATACAGCATTCTTTTGAGAAGTGATGTCTGGCAGGCTTGCACGCTGTTCATAGTCTCGGAACCATTGTACAGTTCTGTTTTAATCTCCAATTCAGTATTCTTTATCGCCATCACTTCTTACACATAGAAGTCCACCGAAAAACTGTCCTGTCACGCCATCTTGGGAAAGTTGTATCATTTCTATTCATAATTTTTGTATGTAAAAGAGTGCGACTAGAATCAGGTAGCAGCTTTCCCATCATGGTACACAACTTGACGTTGTCTTTCAACATGTAATGACTTTGTATAAATTGTGAAGGTTAGTCACTCAGTTTAGCAGGTTTCTATTTTTGCTCCCCAAGTGCAATGGAGAAAACAAAAGTAGAAAGCTAATACATACTCTTTTAGCATCCCaaaaaaaaaaaaaaaaaaaaaaaaaaa


Protein sequences

Name Description Sequence
Ppe.19047 translated coding region predicted by ESTScan from UniGene Ppe.19047

MAGLRVSRVLXRIDFSKVSMEMPGRRSNYTLLSQVPDDQTAAFYDSESKNNKGKAERGFEWETGADFRANRVGNPYSSVGLQRQSSGSSFGESSLSGEYYAPTLSNTAANEIDGFGYVPDDVFKVGGGGEFRMKGGDGAVGTTGGGGSSSGKSWAQQTEESYQLQLALALRLSSEATCTDDPNFLDLVPDVSSSRSSGSVDAVSHRFWVNGCLSYFDIVPDGFYLIHGIDPYVWTVCTDMQENGRIPSIESLRSVDPGIGSSIEVVLIDRRSDPSLKELQNRVFSLSCTCITTKEIVDQLAKLVCNRMGGSASVGEDEFVPIWRESSDDLKDCLGSVVVPIGSLSVGLCRHRALLFKVLADRIDLSCRIAKGCKYCTRDDASSCLVRFGLDREYLVDLIANPGYLCEPDSLLNGPSSISISSPLRFPRLKPVEPTIDFRSLAKQYFSDCQSLNLVFDEASAGSAVDEDNKEFSMYPKQLDRKITEGNNLLLVSSLNDNTSMYAKVSQPSFEDRNPQLFNPSQNIVHTPGMVKDPIPLKRIPPIGHRDVSRVDTTKGSRFVEGVQLVPSKPSKELTFDIEDLDIPWNDLVLKDRIGAGSFGTVHRADWHGSDVAVKILMEQDFHAERFKEFLREVTIMKRLRHPNIVLFMGAVTKPPNLSIVTEYLSRGSLYRLLHKPGAMEALDEKRRLNMAYDVAKGMNYLHRRNPPIVHRDLKSPNLLVDKKYTVKVCDFGLSRLKANTFLSSKSAAGTPEWMAPEVLRDEPSNEKSDVYSFGVILWELATLQQPWGNLNPAQVVAAVGFKNKRLEIPRDLNPQVASIIEACWANEPWKRPSFASIMESLMPLIKPPATQPSRPGVPLLS

Domains

Domain Start-End Description Sequence

Seg: seg
85-97 seg

SSGSSFGESSLSG

Seg: seg
135-153 seg

GGDGAVGTTGGGGSSSGKS

Seg: seg
163-174 seg

QLQLALALRLSS

Seg: seg
186-204 seg

DLVPDVSSSRSSGSVDAVS

HMMPfam: PF14381
199-406 EDR1,Ethylene-responsive protein kinase Le-CTR1

SVDAVSHRFWVNGCLSYFDIVPDGFYLIHGIDPYVWTVCTDMQENGRIPSIESLRSVDPGIGSSIEVVLIDRRSDPSLKELQNRVFSLSCTCITTKEIVDQLAKLVCNRMGGSASVGEDEFVPIWRESSDDLKDCLGSVVVPIGSLSVGLCRHRALLFKVLADRIDLSCRIAKGCKYCTRDDASSCLVRFGLDREYLVDLIANPGYLC

HMMPanther: PTHR23257:SF80
358-847 MAP3K DELTA-1 PROTEIN KINASE,MAP3K DELTA-1 PROTEIN KINASE

VLADRIDLSCRIAKGCKYCTRDDASSCLVRFGLDREYLVDLIANPGYLCEPDSLLNGPSSISISSPLRFPRLKPVEPTIDFRSLAKQYFSDCQSLNLVFDEASAGSAVDEDNKEFSMYPKQLDRKITEGNNLLLVSSLNDNTSMYAKVSQPSFEDRNPQLFNPSQNIVHTPGMVKDPIPLKRIPPIGHRDVSRVDTTKGSRFVEGVQLVPSKPSKELTFDIEDLDIPWNDLVLKDRIGAGSFGTVHRADWHGSDVAVKILMEQDFHAERFKEFLREVTIMKRLRHPNIVLFMGAVTKPPNLSIVTEYLSRGSLYRLLHKPGAMEALDEKRRLNMAYDVAKGMNYLHRRNPPIVHRDLKSPNLLVDKKYTVKVCDFGLSRLKANTFLSSKSAAGTPEWMAPEVLRDEPSNEKSDVYSFGVILWELATLQQPWGNLNPAQVVAAVGFKNKRLEIPRDLNPQVASIIEACWANEPWKRPSFASIMESLMPLIK

HMMPanther: PTHR23257
358-847 FAMILY NOT NAMED,Ser-thr,SERINE-THREONINE PROTEIN KINASE

VLADRIDLSCRIAKGCKYCTRDDASSCLVRFGLDREYLVDLIANPGYLCEPDSLLNGPSSISISSPLRFPRLKPVEPTIDFRSLAKQYFSDCQSLNLVFDEASAGSAVDEDNKEFSMYPKQLDRKITEGNNLLLVSSLNDNTSMYAKVSQPSFEDRNPQLFNPSQNIVHTPGMVKDPIPLKRIPPIGHRDVSRVDTTKGSRFVEGVQLVPSKPSKELTFDIEDLDIPWNDLVLKDRIGAGSFGTVHRADWHGSDVAVKILMEQDFHAERFKEFLREVTIMKRLRHPNIVLFMGAVTKPPNLSIVTEYLSRGSLYRLLHKPGAMEALDEKRRLNMAYDVAKGMNYLHRRNPPIVHRDLKSPNLLVDKKYTVKVCDFGLSRLKANTFLSSKSAAGTPEWMAPEVLRDEPSNEKSDVYSFGVILWELATLQQPWGNLNPAQVVAAVGFKNKRLEIPRDLNPQVASIIEACWANEPWKRPSFASIMESLMPLIK

Seg: seg
487-500 seg

NNLLLVSSLNDNTS

superfamily: SSF56112
IPR011009
560-861 Protein kinase-like (PK-like)
Protein kinase-like domain

VEGVQLVPSKPSKELTFDIEDLDIPWNDLVLKDRIGAGSFGTVHRADWHGSDVAVKILMEQDFHAERFKEFLREVTIMKRLRHPNIVLFMGAVTKPPNLSIVTEYLSRGSLYRLLHKPGAMEALDEKRRLNMAYDVAKGMNYLHRRNPPIVHRDLKSPNLLVDKKYTVKVCDFGLSRLKANTFLSSKSAAGTPEWMAPEVLRDEPSNEKSDVYSFGVILWELATLQQPWGNLNPAQVVAAVGFKNKRLEIPRDLNPQVASIIEACWANEPWKRPSFASIMESLMPLIKPPATQPSRPGVPLL

Gene3D: G3DSA:3.30.200.20
566-650 no description

VPSKPSKELTFDIEDLDIPWNDLVLKDRIGAGSFGTVHRADWHGSDVAVKILMEQDFHAERFKEFLREVTIMKRLRHPNIVLFMG

ProfileScan: PS50011
IPR000719
588-846 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

LVLKDRIGAGSFGTVHRADWHGSDVAVKILMEQDFHAERFKEFLREVTIMKRLRHPNIVLFMGAVTKPPNLSIVTEYLSRGSLYRLLHKPGAMEALDEKRRLNMAYDVAKGMNYLHRRNPPIVHRDLKSPNLLVDKKYTVKVCDFGLSRLKANTFLSSKSAAGTPEWMAPEVLRDEPSNEKSDVYSFGVILWELATLQQPWGNLNPAQVVAAVGFKNKRLEIPRDLNPQVASIIEACWANEPWKRPSFASIMESLMPLI

HMMSmart: SM00220
IPR002290
588-846 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

LVLKDRIGAGSFGTVHRADWHGSDVAVKILMEQDFHAERFKEFLREVTIMKRLRHPNIVLFMGAVTKPPNLSIVTEYLSRGSLYRLLHKPGAMEALDEKRRLNMAYDVAKGMNYLHRRNPPIVHRDLKSPNLLVDKKYTVKVCDFGLSRLKANTFLSSKSAAGTPEWMAPEVLRDEPSNEKSDVYSFGVILWELATLQQPWGNLNPAQVVAAVGFKNKRLEIPRDLNPQVASIIEACWANEPWKRPSFASIMESLMPLI

HMMSmart: SM00219
IPR020635
588-842 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

LVLKDRIGAGSFGTVHRADWHGSDVAVKILMEQDFHAERFKEFLREVTIMKRLRHPNIVLFMGAVTKPPNLSIVTEYLSRGSLYRLLHKPGAMEALDEKRRLNMAYDVAKGMNYLHRRNPPIVHRDLKSPNLLVDKKYTVKVCDFGLSRLKANTFLSSKSAAGTPEWMAPEVLRDEPSNEKSDVYSFGVILWELATLQQPWGNLNPAQVVAAVGFKNKRLEIPRDLNPQVASIIEACWANEPWKRPSFASIMESL

HMMPfam: PF07714
IPR001245
589-842 Pkinase_Tyr
Serine-threonine/tyrosine-protein kinase

VLKDRIGAGSFGTVHRADWHGSDVAVKILMEQDFHAERFKEFLREVTIMKRLRHPNIVLFMGAVTKPPNLSIVTEYLSRGSLYRLLHKPGAMEALDEKRRLNMAYDVAKGMNYLHRRNPPIVHRDLKSPNLLVDKKYTVKVCDFGLSRLKANTFLSSKSAAGTPEWMAPEVLRDEPSNEKSDVYSFGVILWELATLQQPWGNLNPAQVVAAVGFKNKRLEIPRDLNPQVASIIEACWANEPWKRPSFASIMESL

PatternScan: PS00107
IPR017441
594-615 PROTEIN_KINASE_ATP
Protein kinase, ATP binding site

IGAGSFGTVHRADWHGSDVAVK

Gene3D: G3DSA:1.10.510.10
651-841 no description

AVTKPPNLSIVTEYLSRGSLYRLLHKPGAMEALDEKRRLNMAYDVAKGMNYLHRRNPPIVHRDLKSPNLLVDKKYTVKVCDFGLSRLKANTFLSSKSAAGTPEWMAPEVLRDEPSNEKSDVYSFGVILWELATLQQPWGNLNPAQVVAAVGFKNKRLEIPRDLNPQVASIIEACWANEPWKRPSFASIMES

FPrintScan: PR00109
IPR001245
662-675 TYRKINASE
Serine-threonine/tyrosine-protein kinase

TEYLSRGSLYRLLH

FPrintScan: PR00109
IPR001245
703-721 TYRKINASE
Serine-threonine/tyrosine-protein kinase

HRRNPPIVHRDLKSPNLLV

PatternScan: PS00108
IPR008271
709-721 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

IVHRDLKSPNLLV

FPrintScan: PR00109
IPR001245
750-760 TYRKINASE
Serine-threonine/tyrosine-protein kinase

GTPEWMAPEVL

FPrintScan: PR00109
IPR001245
769-791 TYRKINASE
Serine-threonine/tyrosine-protein kinase

SDVYSFGVILWELATLQQPWGNL

FPrintScan: PR00109
IPR001245
813-835 TYRKINASE
Serine-threonine/tyrosine-protein kinase

LNPQVASIIEACWANEPWKRPSF






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox