PRGDB00074326 (Ppe.19091)

From PRG Wiki
Jump to: navigation, search
Ppe.19091
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 47059738 (AY599223)
Gene Class NL
Domain Type NBS, LRR, Others
Gene Species Prunus persica

Comment?

Prunus persica putative NBS-LRR type disease resistance protein (RPM1) mRNA, complete cds

DNA Sequence

ATATGGACTCAGCTCCAACAGCTCTCTTGGTTGGCAAAATTATGGACATTCTCGAGAACGAAGCATACTCCATAGCCGCTGTCCGTGATGAAGTTGATGAGATTAAGCAGGAGCTGGTAAGCATGACATCCTTCCTAGAGGATGTTGAGGGCAAGAAAACACAGACAGAAACACAGAAAGCTTGGGTCACAAGTGTCAAAGACTTAACCAGTGATGTTGAAGATATCATCGATGAATTCATGTATCATACGTATGAGCAGCAAAGTAGGGGACGATTTGCAAGGTGGCTCCACAGGACCATTCATATTCCAAAGAATCTCTTCTATCGGCGTAAAATTGCCAACAAGTTACACAAAATCACTAAAATGATCAAGGCCATTCCAGAGAGAAATAGGAGATATGCTCTTGATGGTGTAGTAGGAACAAGTTGGGATGATATTAGCAAATGGGTCAAGAACCAAGCAGTGTCTTCTCTCTTTATTAACAAAGATGAACTCGTCGGGATTGATGGAAAGAAGCAAACATTAACTGCATGGCTGCTCAATGAAGAGCAGCACCTAACTGTTGTCTCCGTGGTCGGGATGGGAGGATCCGGGAAAACAACTCTAGTTGCCAAAACCTTCGCCAACGAAACTGTAAAGAGACATTTTGATTCTTATGCTTGGATCACTGTCTCCCAAACTTATGTGATTGAAGACTTGTTTCGGAGCTTGATCAAGGAACTCCACCAAACAAGGAAAGAAGATGTCCCTGCAGACCCGATATCCATGAGCTACAGAGACTTGCTACAACTTCTGGTGAACTACCTGGAGTCTAAAAGGTACCTAGTAGTACTGGATGACGTGTGGGATATCAAACTTTGGAGAGAAATAAGGATAGCACTTCCAGATAGACAGCTTGGAAGTCGAATCATGCTTACAACTCGAAAAGAAGACATAGCATCCCATTGTTTTGGAGTTGAAAGCCATGTTCACTGTATGCAACCGCTGGAAAAGAATTACGCTTGGGAGCTTTTCAGCAGGAAATCATTCTCTACCTTTGATGGTAAATGTTGTCCACCAGAGCTTGAAAAATTAGCTTGGGAACTCATGGAAAAGTGTAAAGGCCTACCTCTAGCTATCATAGCTTTAGGTGGTCTTATGTCTTCCAAGAAATTAGCTGCGGAGTGGAGTAAAGTCTACAATGGCTTAAATTGGCATCTAACAAGCCATCATTTGTTAGAACCTGTGAAGAGCATCTTGTTACTTAGTTTCAATGATTTGCCATATCGCTTGAAGCATTGTTTTCTATATTGTTCCCTTTTTCCAGAAGATTATTTGATTCGAAGGAAAAGGCTCATTAGGTTATGGATAGCTGAAGGATTTGTTGAACATGCTAGAGGGGTCACACCTGAACAAGTTGCAGATAGCTATCTTATGGAACTCATTTTTCGTAACATGCTACAAGTTGTAGAGAGGAATGAAACCGGTAGGCCAAAATCATGTAAGATGCATGACCTTATGCGAGAGCTTGCTCTGTCAACATCTGAGAAAGAAAAATTTTCTATTGTACATGATGGGAAAGAAGTACTGGAAGACATTGGAGCCCGCCGTTTGTCAATCCAAACAACCCAAGGAGGAATTGAATCTTGCATTGGTATGTCACGCCCTCGTTCTTTTCTTGTATTCGTTACTGGCATATTCTCATTTTCTTTCTCAAAGTCATTGCCTTCTGGATTCAAATTGTTGAGGGTTTTAGATTTGGAGGATGTCCAAATTGATAAGCTGCCACATAATTTAGTGTACTTATTCAACTTAAGATACTTAAGTTTGAAGGGAACTCAAATTAAGGAGCTTCCAAAAGCCATAGGACTGCTCCGCAACCTTCAGACATTGAACATCCTCAATACTAAGATAGAGGTACTTCCCAGAGGTATTTCCAAGTTGCAAAACCTGCGCCATCTAATTATGCTCCGTCATTCTGGAGAGTATATGGCCTTCAAAACTGCCCATGGGACAAGAGTGCCATTTAATATTAGTAAGCTGAAGAAATTGGAAGTTTTGTCATGTGTTGAATCAGAAGGAAACATTATAAGGCTCATTGGGAATATGACTCAACTTACAAGGATTGGCATTACGAATGTAAAAGAGAGAGACGCAATGGACCTATGTGATTCAATTCAAAAGTTGAAGCTACTTCAGTGCTTGGCTTTAAGGGTAAGTGGTGAGGAGGAGTTTCTTGACGTCAATGCATTATCTTCACCTCCTCCACACCTTCGAAAACTTATTTTTGGCAGCAAGCTGCAAAAGGTACCACCTTGGTTCTCTTCGCTCCAGAACCTTACATATCTGTATCTTCATTGGACGAGACTTGACGAGGATTTACTACCTCATATTGAAGCATTGCCATGTCTGGGAAGGCTTTTACTTGTCAATGCCTATGTTGGTAATGAGTTGTGTTTCAACAGAGGCTTTCCAAAGCTTACTATTCTGGAGTTGTTTAATTTCCCCTTATTGAATAAGATAACTATAGCAGAAGGGGTGATGAGGAATCTCCGGTTATTAACACTTGCTAGATGTATGGAGTTAAAGGCATTGCCACAGGGTTTTGAATACCTTAGTAAGCTAGAAACACTTGAATTGTTGTCTGTTTCAATGCAACTTATAGAGTCCATACAAGAAGGAGGGGTGGATCATCCAACGGTAAAACACATCACCGTCATTACAAATTATTCTTTGAAATGCTTGATAAGAGCTCATCATAGTTCATCCACATGAAGAATCTAGGCTGAGAGGTGAAGATTCAATCCTGTTTGCGCCAGGAAGAACCCTTTCTGTTGTGAAGCTGCAAACACTAAATCTTATTTTCTTTTGTTAATGCTTGAATCAAGTAATACCAAGACTCTCTGCTCATAGATTGCATTTTCAGTACTGTCTGTTTGTATGTCTTGTAATATTGTTGGAGATTGACTCACTTTAGTAGCAATTGATAACAGATTTGAGCCTaaaaaaaaaaaaaaaaaaaaaaa


Protein sequences

Name Description Sequence
Ppe.19091 translated coding region predicted by ESTScan from UniGene Ppe.19091

XMDSAPTALLVGKIMDILENEAYSIAAVRDEVDEIKQELVSMTSFLEDVEGKKTQTETQKAWVTSVKDLTSDVEDIIDEFMYHTYEQQSRGRFARWLHRTIHIPKNLFYRRKIANKLHKITKMIKAIPERNRRYALDGVVGTSWDDISKWVKNQAVSSLFINKDELVGIDGKKQTLTAWLLNEEQHLTVVSVVGMGGSGKTTLVAKTFANETVKRHFDSYAWITVSQTYVIEDLFRSLIKELHQTRKEDVPADPISMSYRDLLQLLVNYLESKRYLVVLDDVWDIKLWREIRIALPDRQLGSRIMLTTRKEDIASHCFGVESHVHCMQPLEKNYAWELFSRKSFSTFDGKCCPPELEKLAWELMEKCKGLPLAIIALGGLMSSKKLAAEWSKVYNGLNWHLTSHHLLEPVKSILLLSFNDLPYRLKHCFLYCSLFPEDYLIRRKRLIRLWIAEGFVEHARGVTPEQVADSYLMELIFRNMLQVVERNETGRPKSCKMHDLMRELALSTSEKEKFSIVHDGKEVLEDIGARRLSIQTTQGGIESCIGMSRPRSFLVFVTGIFSFSFSKSLPSGFKLLRVLDLEDVQIDKLPHNLVYLFNLRYLSLKGTQIKELPKAIGLLRNLQTLNILNTKIEVLPRGISKLQNLRHLIMLRHSGEYMAFKTAHGTRVPFNISKLKKLEVLSCVESEGNIIRLIGNMTQLTRIGITNVKERDAMDLCDSIQKLKLLQCLALRVSGEEEFLDVNALSSPPPHLRKLIFGSKLQKVPPWFSSLQNLTYLYLHWTRLDEDLLPHIEALPCLGRLLLVNAYVGNELCFNRGFPKLTILELFNFPLLNKITIAEGVMRNLRLLTLARCMELKALPQGFEYLSKLETLELLSVSMQLIESIQEGGVDHPTVKHITVITNYSLKCLIRAHHSSST

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR23155:SF234
3-904 RPM1 (RESISTANCE TO P. SYRINGAE PV MACULICOLA 1); PROTEIN BINDING,RPM1 (RESISTANCE TO P. SYRINGAE PV MACULICOLA 1)

DSAPTALLVGKIMDILENEAYSIAAVRDEVDEIKQELVSMTSFLEDVEGKKTQTETQKAWVTSVKDLTSDVEDIIDEFMYHTYEQQSRGRFARWLHRTIHIPKNLFYRRKIANKLHKITKMIKAIPERNRRYALDGVVGTSWDDISKWVKNQAVSSLFINKDELVGIDGKKQTLTAWLLNEEQHLTVVSVVGMGGSGKTTLVAKTFANETVKRHFDSYAWITVSQTYVIEDLFRSLIKELHQTRKEDVPADPISMSYRDLLQLLVNYLESKRYLVVLDDVWDIKLWREIRIALPDRQLGSRIMLTTRKEDIASHCFGVESHVHCMQPLEKNYAWELFSRKSFSTFDGKCCPPELEKLAWELMEKCKGLPLAIIALGGLMSSKKLAAEWSKVYNGLNWHLTSHHLLEPVKSILLLSFNDLPYRLKHCFLYCSLFPEDYLIRRKRLIRLWIAEGFVEHARGVTPEQVADSYLMELIFRNMLQVVERNETGRPKSCKMHDLMRELALSTSEKEKFSIVHDGKEVLEDIGARRLSIQTTQGGIESCIGMSRPRSFLVFVTGIFSFSFSKSLPSGFKLLRVLDLEDVQIDKLPHNLVYLFNLRYLSLKGTQIKELPKAIGLLRNLQTLNILNTKIEVLPRGISKLQNLRHLIMLRHSGEYMAFKTAHGTRVPFNISKLKKLEVLSCVESEGNIIRLIGNMTQLTRIGITNVKERDAMDLCDSIQKLKLLQCLALRVSGEEEFLDVNALSSPPPHLRKLIFGSKLQKVPPWFSSLQNLTYLYLHWTRLDEDLLPHIEALPCLGRLLLVNAYVGNELCFNRGFPKLTILELFNFPLLNKITIAEGVMRNLRLLTLARCMELKALPQGFEYLSKLETLELLSVSMQLIESIQEGGVDHPTVKHITVITNY

HMMPanther: PTHR23155
3-904 FAMILY NOT NAMED,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

DSAPTALLVGKIMDILENEAYSIAAVRDEVDEIKQELVSMTSFLEDVEGKKTQTETQKAWVTSVKDLTSDVEDIIDEFMYHTYEQQSRGRFARWLHRTIHIPKNLFYRRKIANKLHKITKMIKAIPERNRRYALDGVVGTSWDDISKWVKNQAVSSLFINKDELVGIDGKKQTLTAWLLNEEQHLTVVSVVGMGGSGKTTLVAKTFANETVKRHFDSYAWITVSQTYVIEDLFRSLIKELHQTRKEDVPADPISMSYRDLLQLLVNYLESKRYLVVLDDVWDIKLWREIRIALPDRQLGSRIMLTTRKEDIASHCFGVESHVHCMQPLEKNYAWELFSRKSFSTFDGKCCPPELEKLAWELMEKCKGLPLAIIALGGLMSSKKLAAEWSKVYNGLNWHLTSHHLLEPVKSILLLSFNDLPYRLKHCFLYCSLFPEDYLIRRKRLIRLWIAEGFVEHARGVTPEQVADSYLMELIFRNMLQVVERNETGRPKSCKMHDLMRELALSTSEKEKFSIVHDGKEVLEDIGARRLSIQTTQGGIESCIGMSRPRSFLVFVTGIFSFSFSKSLPSGFKLLRVLDLEDVQIDKLPHNLVYLFNLRYLSLKGTQIKELPKAIGLLRNLQTLNILNTKIEVLPRGISKLQNLRHLIMLRHSGEYMAFKTAHGTRVPFNISKLKKLEVLSCVESEGNIIRLIGNMTQLTRIGITNVKERDAMDLCDSIQKLKLLQCLALRVSGEEEFLDVNALSSPPPHLRKLIFGSKLQKVPPWFSSLQNLTYLYLHWTRLDEDLLPHIEALPCLGRLLLVNAYVGNELCFNRGFPKLTILELFNFPLLNKITIAEGVMRNLRLLTLARCMELKALPQGFEYLSKLETLELLSVSMQLIESIQEGGVDHPTVKHITVITNY

superfamily: SSF52540
149-403 P-loop containing nucleoside triphosphate hydrolases

KWVKNQAVSSLFINKDELVGIDGKKQTLTAWLLNEEQHLTVVSVVGMGGSGKTTLVAKTFANETVKRHFDSYAWITVSQTYVIEDLFRSLIKELHQTRKEDVPADPISMSYRDLLQLLVNYLESKRYLVVLDDVWDIKLWREIRIALPDRQLGSRIMLTTRKEDIASHCFGVESHVHCMQPLEKNYAWELFSRKSFSTFDGKCCPPELEKLAWELMEKCKGLPLAIIALGGLMSSKKLAAEWSKVYNGLNWHLTS

Gene3D: G3DSA:3.40.50.300
171-315 no description

GKKQTLTAWLLNEEQHLTVVSVVGMGGSGKTTLVAKTFANETVKRHFDSYAWITVSQTYVIEDLFRSLIKELHQTRKEDVPADPISMSYRDLLQLLVNYLESKRYLVVLDDVWDIKLWREIRIALPDRQLGSRIMLTTRKEDIAS

HMMPfam: PF00931
IPR002182
172-458 NB-ARC,NBS
NB-ARC

KKQTLTAWLLNEEQHLTVVSVVGMGGSGKTTLVAKTFANETVKRHFDSYAWITVSQTYVIEDLFRSLIKELHQTRKEDVPADPISMSYRDLLQLLVNYLESKRYLVVLDDVWDIKLWREIRIALPDRQLGSRIMLTTRKEDIASHCFGVESHVHCMQPLEKNYAWELFSRKSFSTFDGKCCPPELEKLAWELMEKCKGLPLAIIALGGLMSSKKLAAEWSKVYNGLNWHLTSHHLLEPVKSILLLSFNDLPYRLKHCFLYCSLFPEDYLIRRKRLIRLWIAEGFVEH

Seg: seg
189-199 seg

VVSVVGMGGSG

FPrintScan: PR00364
IPR000767
189-204 DISEASERSIST
Disease resistance protein

VVSVVGMGGSGKTTLV

FPrintScan: PR00364
IPR000767
269-283 DISEASERSIST
Disease resistance protein

YLESKRYLVVLDDVW

FPrintScan: PR00364
IPR000767
367-381 DISEASERSIST
Disease resistance protein

CKGLPLAIIALGGLM

Seg: seg
369-380 seg

GLPLAIIALGGL

Seg: seg
440-451 seg

LIRRKRLIRLWI

superfamily: SSF52058
496-910 L domain-like,LRR

KMHDLMRELALSTSEKEKFSIVHDGKEVLEDIGARRLSIQTTQGGIESCIGMSRPRSFLVFVTGIFSFSFSKSLPSGFKLLRVLDLEDVQIDKLPHNLVYLFNLRYLSLKGTQIKELPKAIGLLRNLQTLNILNTKIEVLPRGISKLQNLRHLIMLRHSGEYMAFKTAHGTRVPFNISKLKKLEVLSCVESEGNIIRLIGNMTQLTRIGITNVKERDAMDLCDSIQKLKLLQCLALRVSGEEEFLDVNALSSPPPHLRKLIFGSKLQKVPPWFSSLQNLTYLYLHWTRLDEDLLPHIEALPCLGRLLLVNAYVGNELCFNRGFPKLTILELFNFPLLNKITIAEGVMRNLRLLTLARCMELKALPQGFEYLSKLETLELLSVSMQLIESIQEGGVDHPTVKHITVITNYSLKCLI

Gene3D: G3DSA:3.80.10.10
572-648 no description

GFKLLRVLDLEDVQIDKLPHNLVYLFNLRYLSLKGTQIKELPKAIGLLRNLQTLNILNTKIEVLPRGISKLQNLRHL

Gene3D: G3DSA:3.80.10.10
672-875 no description

ISKLKKLEVLSCVESEGNIIRLIGNMTQLTRIGITNVKERDAMDLCDSIQKLKLLQCLALRVSGEEEFLDVNALSSPPPHLRKLIFGSKLQKVPPWFSSLQNLTYLYLHWTRLDEDLLPHIEALPCLGRLLLVNAYVGNELCFNRGFPKLTILELFNFPLLNKITIAEGVMRNLRLLTLARCMELKALPQGFEYLSKLETLELL

FPrintScan: PR00364
IPR000767
840-856 DISEASERSIST
Disease resistance protein

GVMRNLRLLTLARCMEL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox