PRGDB00074331 (Ppe.19996)

From PRG Wiki
Jump to: navigation, search
Ppe.19996
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 209178848 (FC860766)
Gene Class Unknown
Domain Type
Gene Species Prunus persica

Comment?

PP1005D10-T7 PP1 Prunus persica cDNA clone PP1005D10, mRNA sequence

DNA Sequence

GATCCTCCTTACCACTCACTACTTCTCCATTCATTTTCTCTCTCTGCatgagaattgagaattgagaattgagaattgagagagggagagagaggaagagagTTCTAGGGTTACTCATATCATCACCAACTGAGTCTAAGCTTCTTCTTCTATCCTTTTAGTTTTCATTTTGTGAGAGAGAGAGTTTCACTTTGAGTTTGCTGTCATGGGTGCACTAGCAGACAGCCACCATCCTTGGGCATTCACATTTGGTATCCTAGGAAATGTAATCTCGTTCTTGGTTTACCTAGCCCCAGTGCCCACATTTTATGGAATTTACAAGAAAAAATCAACTCAAGGTTTCCAATCGGTGCCATATCTGGTAGCATTGTTCAGTGGGATGCTTTGGTTCTACTATGCGTTGCTGAAAAAGAATGCTATGCTTCTCATCACCATTAACTCCTTCGGAACTGTAATAGAAACTATCTACATCGTCATGTTCATTTTTTATGCACCAAAGGATGCTAGGAAATTCACCCTGAAACTATTTGGTTTTATGAACGTGGGGCTCTTCTGCTCGATCCTTGTCCTTTCACACTTTGCTGTGAGAAGTGAATACCGGGTCCCAGTTCTTGGCTGGATCTATGTCGCCATTTCTGTCATTGTTTTTGCTGCCCCCCTTAGTATTGTGGCACATGTCATCCGAACAAGGAGTGTGGATTCATGCCATTTAG


Protein sequences

Name Description Sequence
Ppe.19996 translated coding region predicted by ESTScan from UniGene Ppe.19996

MGALADSHHPWAFTFGILGNVISFLVYLAPVPTFYGIYKKKSTQGFQSVPYLVALFSGMLWFYYALLKKNAMLLITINSFGTVIETIYIVMFIFYAPKDARKFTLKLFGFMNVGLFCSILVLSHFAVRSEYRVPVLGWIYVAISVIVFAAPLSIVAHVIRTRSVDSCHLX


Domains

Domain Start-End Description Sequence

HMMPanther: PTHR10791
IPR004316
7-166 RAG1-ACTIVATING PROTEIN 1
RAG1-activating protein-1-related

SHHPWAFTFGILGNVISFLVYLAPVPTFYGIYKKKSTQGFQSVPYLVALFSGMLWFYYALLKKNAMLLITINSFGTVIETIYIVMFIFYAPKDARKFTLKLFGFMNVGLFCSILVLSHFAVRSEYRVPVLGWIYVAISVIVFAAPLSIVAHVIRTRSVDS

HMMPfam: PF03083
IPR004316
13-99 MtN3_slv
RAG1-activating protein-1-related

FTFGILGNVISFLVYLAPVPTFYGIYKKKSTQGFQSVPYLVALFSGMLWFYYALLKKNAMLLITINSFGTVIETIYIVMFIFYAPKD

HMMPfam: PF03083
IPR004316
135-167 MtN3_slv
RAG1-activating protein-1-related

VLGWIYVAISVIVFAAPLSIVAHVIRTRSVDSC






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox