PRGDB00074337 (Ppe.20514)

From PRG Wiki
Jump to: navigation, search
Ppe.20514
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 209178886 (FC863784)
Gene Class Unknown
Domain Type
Gene Species Prunus persica

Comment?

PPN041B08-T7 PPN Prunus persica cDNA clone PPN041B08, mRNA sequence

DNA Sequence

GAGGCTCGCGAAGAACAACGTTCACAGAGCGAACCTTTCACAACACAAACCCGAAAATCTCCTACAGCGTCGCCACCAATCCATCGAAGAACATGGCGACGTTTGAGCTCTACAGGAGGTCGACGATCGGAATGTGTTTGACTGAGACTTTGGATGAGATGGTTCAGAACGGTACTCTCAGTCCCGAGCTCGCCATTCAGGTTCTCGTTCAGTTCGACAAGTCAATGACTGAAGCTTTGGAAACCCAAGTGAAGAGCAAGGTCAGCATCAAGGGACATCTGCACACCTACAGATTCTGCGACAATGTTTGGACCTTCATCTTACAGGACGCTTTGTTCAAGAACGAGGATAGCCAGGAAACTGTTGGCCGTGTTAAAATAGTGGCATGTGACTCAAAGCTGCTCACACAATGAGATGTCAGACTAATGGTGGTAAAGTTAAATAAGAACTTTGTAACCTGTTGCTATAGAGGGTGAGGAGAAGGTGGCAGTTAATCTGGTTAGTTGCAGGAACTGGAAAACTGTAGGAGATTGAACATAAAATTGTAAAGCCCTCTATCTTGACACTTATAGTTATTTGTTGTTACATTGAGGATGGTGTGTGCTTGTTCATAGATCTTCGTTCAATGTTCTATTGTTGTTTTGAGAAAGATGAAACAGTTGGAGATGAACACGTCGATGCTTGTATTATGGACTGTCTATTCACAGTACTGAAATATGCTTANTCATCAGCAT


Protein sequences

Name Description Sequence
Ppe.20514 translated coding region predicted by ESTScan from UniGene Ppe.20514

XGSRRTTFTERTFHNTNPKISYSVATNPSKNMATFELYRRSTIGMCLTETLDEMVQNGTLSPELAIQVLVQFDKSMTEALETQVKSKVSIKGHLHTYRFCDNVWTFILQDALFKNEDSQETVGRVKIVACDSKLLTQ

Domains

Domain Start-End Description Sequence

Gene3D: G3DSA:1.10.287.190
IPR015872
31-85 no description
Transcription initiation factor IIA, gamma subunit

NMATFELYRRSTIGMCLTETLDEMVQNGTLSPELAIQVLVQFDKSMTEALETQVK

BlastProDom: PD009224
IPR015872
32-81 T2AG_ARATH_Q39236;
Transcription initiation factor IIA, gamma subunit

MATFELYRRSTIGMCLTETLDEMVQNGTLSPELAIQVLVQFDKSMTEALE

HMMPanther: PTHR10966
IPR003194
32-134 TRANSCRIPTION INITIATION FACTOR IIA SUBUNIT 2
Transcription initiation factor IIA, gamma subunit

MATFELYRRSTIGMCLTETLDEMVQNGTLSPELAIQVLVQFDKSMTEALETQVKSKVSIKGHLHTYRFCDNVWTFILQDALFKNEDSQETVGRVKIVACDSKL

HMMPfam: PF02268
IPR015872
34-81 TFIIA_gamma_N
Transcription initiation factor IIA, gamma subunit

TFELYRRSTIGMCLTETLDEMVQNGTLSPELAIQVLVQFDKSMTEALE

superfamily: SSF47396
IPR009083
35-85 Transcription factor IIA (TFIIA), alpha-helical domain
Transcription factor IIA, helical

FELYRRSTIGMCLTETLDEMVQNGTLSPELAIQVLVQFDKSMTEALETQVK

superfamily: SSF50784
IPR009088
83-133 Transcription factor IIA (TFIIA), beta-barrel domain
Transcription factor IIA, beta-barrel

QVKSKVSIKGHLHTYRFCDNVWTFILQDALFKNEDSQETVGRVKIVACDSK

HMMPfam: PF02751
IPR015871
83-132 TFIIA_gamma_C
Transcription initiation factor IIA, gamma subunit

QVKSKVSIKGHLHTYRFCDNVWTFILQDALFKNEDSQETVGRVKIVACDS

Gene3D: G3DSA:2.30.18.10
IPR009088
86-136 no description
Transcription factor IIA, beta-barrel

SKVSIKGHLHTYRFCDNVWTFILQDALFKNEDSQETVGRVKIVACDSKLLT






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox