PRGDB00074536 (Psi.12477)

From PRG Wiki
Jump to: navigation, search
Psi.12477
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 148808243 (ES659165)
Gene Class NL
Domain Type NBS, LRR, Others
Gene Species Picea sitchensis

Comment?

WS0386.C21_D15 SS-B-23 Picea sitchensis cDNA clone WS0386_D15 3', mRNA sequence

DNA Sequence

GTTGAAAAACCAAGATTGAATGTAGCCGACTATCCAACTGGGTTGGCTGAGAAGGTTCAAGATTTTGAAAATAAAATTTTATTGCAGCAAAAAACATAGTGCAAAACCTCAGGTAGTAGGAATTATTGGTTTAGGGGGGGTAGGAAAGACAACCTTAGCAAAACAACTATTCAATTTAAAGAGCTCAGATTACGATAAATCTTGCTTTTTACCTGATATTAGAGAAATTGCAAGTACACCCTCTTTAATTTTATCATTGCAGAAGAAACTTCTTGAAAGCTTGATTGGATCAGATCCGAAAATAGACAATATCGATGTAGGCATAACGACACTTGAAAAACATCTCTCATCCCATAAGGCCTTAGTCATTTTAGATGACGTAGATAGCGAGTCTCTGGTGAAAAAACTTTTCCCAGTTCAAACTGTTCTACACGCTGACAGTTTAATATTGATTACATCTCGGAACAGAGATGTGCTCACAAGCTCAGGAGTGGAAGACTCATTAATATATACCCTCACTGGCCTTAAGGAAGAACACTCTCGAGAACTCTTTTGCTTGCATTCCTTCGGGCGTCTACGTCCAGCCGAAGGATTTGAATCTCTTGTAGACAGATTTCTAGTAGCCTGTGAAGGTTTGCCTCTATCTTTGAAAGTGTTTGGGGCACTCCTTTGTGGGAAAAACACATTTTACTGGGAACAACAATTGAATAGACTTCAACAGATACTTCCAGGGGAGATAAAACTAAGACTTAAAATTAGTTTGGATCCTAAAGGGCCAGaaaaaaaaaaaaaaaa


Protein sequences

Name Description Sequence
Psi.12477 translated coding region predicted by ESTScan from UniGene Psi.12477

VEKPRLNVADYPTGLAEKVQDFENKILLQQKTSAKPQVVGIIGLGGVGKTTLAKQLFNLKSSDYDKSCFLPDIREIASTPSLILSLQKKLLESLIGSDPKIDNIDVGITTLEKHLSSHKALVILDDVDSESLVKKLFPVQTVLHADSLILITSRNRDVLTSSGVEDSLIYTLTGLKEEHSRELFCLHSFGRLRPAEGFESLVDRFLVACEGLPLSLKVFGALLCGKNTFYWEQQLNRLQQILPGEXKTKT

Domains

Domain Start-End Description Sequence

Gene3D: G3DSA:3.40.50.300
24-156 no description

NKILLQQKTSAKPQVVGIIGLGGVGKTTLAKQLFNLKSSDYDKSCFLPDIREIASTPSLILSLQKKLLESLIGSDPKIDNIDVGITTLEKHLSSHKALVILDDVDSESLVKKLFPVQTVLHADSLILITSRNR

HMMPfam: PF00931
IPR002182
29-243 NB-ARC,NBS
NB-ARC

QQKTSAKPQVVGIIGLGGVGKTTLAKQLFNLKSSDYDKSCFLPDIREIASTPSLILSLQKKLLESLIGSDPKIDNIDVGITTLEKHLSSHKALVILDDVDSESLVKKLFPVQTVLHADSLILITSRNRDVLTSSGVEDSLIYTLTGLKEEHSRELFCLHSFGRLRPAEGFESLVDRFLVACEGLPLSLKVFGALLCGKNTFYWEQQLNRLQQILP

superfamily: SSF52540
34-246 P-loop containing nucleoside triphosphate hydrolases

AKPQVVGIIGLGGVGKTTLAKQLFNLKSSDYDKSCFLPDIREIASTPSLILSLQKKLLESLIGSDPKIDNIDVGITTLEKHLSSHKALVILDDVDSESLVKKLFPVQTVLHADSLILITSRNRDVLTSSGVEDSLIYTLTGLKEEHSRELFCLHSFGRLRPAEGFESLVDRFLVACEGLPLSLKVFGALLCGKNTFYWEQQLNRLQQILPGEX

HMMSmart: SM00382
IPR003593
35-175 ATPases associated with a variety of cellula,NBS
AAA+ ATPase domain

KPQVVGIIGLGGVGKTTLAKQLFNLKSSDYDKSCFLPDIREIASTPSLILSLQKKLLESLIGSDPKIDNIDVGITTLEKHLSSHKALVILDDVDSESLVKKLFPVQTVLHADSLILITSRNRDVLTSSGVEDSLIYTLTGL

Seg: seg
38-48 seg

VVGIIGLGGVG

FPrintScan: PR00364
IPR000767
38-53 DISEASERSIST
Disease resistance protein

VVGIIGLGGVGKTTLA

HMMPanther: PTHR11017:SF20
38-245 SUBFAMILY NOT NAMED,SUBFAMILY NOT NAMED

VVGIIGLGGVGKTTLAKQLFNLKSSDYDKSCFLPDIREIASTPSLILSLQKKLLESLIGSDPKIDNIDVGITTLEKHLSSHKALVILDDVDSESLVKKLFPVQTVLHADSLILITSRNRDVLTSSGVEDSLIYTLTGLKEEHSRELFCLHSFGRLRPAEGFESLVDRFLVACEGLPLSLKVFGALLCGKNTFYWEQQLNRLQQILPGE

HMMPanther: PTHR11017
38-245 FAMILY NOT NAMED,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

VVGIIGLGGVGKTTLAKQLFNLKSSDYDKSCFLPDIREIASTPSLILSLQKKLLESLIGSDPKIDNIDVGITTLEKHLSSHKALVILDDVDSESLVKKLFPVQTVLHADSLILITSRNRDVLTSSGVEDSLIYTLTGLKEEHSRELFCLHSFGRLRPAEGFESLVDRFLVACEGLPLSLKVFGALLCGKNTFYWEQQLNRLQQILPGE

FPrintScan: PR00364
IPR000767
114-128 DISEASERSIST
Disease resistance protein

HLSSHKALVILDDVD

FPrintScan: PR00364
IPR000767
209-223 DISEASERSIST
Disease resistance protein

CEGLPLSLKVFGALL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox