PRGDB00074539 (Psi.12642)

From PRG Wiki
Jump to: navigation, search
Psi.12642
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 148809250 (ES660172)
Gene Class Unknown
Domain Type LRR
Gene Species Picea sitchensis

Comment?

WS03910.C21_F23 SS-B-24 Picea sitchensis cDNA clone WS03910_F23 3', mRNA sequence

DNA Sequence

CATGGAGGAGGAGGAGGTCGGCGTCATCTGCAACTGTGCCTTCAACAAAAATGCCACTTGCCATGTCATTCAAATAAAAGTTCGGTATGAAGAAATGACGGGAATTATCCCGCCGGAGATGGCTAATCTCACATATCTGGAAAACATAGATTTGAGATACAACCTTTTGCATGGATCGATCCCGGCATCGCTGGGCTCCTTGACTAGCTTGCAATATCTGTTGTTCGGAAGAAATAATTTGTCTGGTGAAATTCCAAAGGAATGGGGGAAGCTCACCAATTTGTTAGTACTGGGTTTTGGCCAGAACTATTTATCCGGGACGATACCTCCAGAGCTGGGGAACTTGACAAAACTGGAGCAATTGATAATGTGGATGATTAATTCAAAGAGACTTCTCGAATATCTCTTCCATCATTCCAAAGGAGATAATTATTCAAGCCTCTTTTCAAGGAGAAGATCATGGAGATTTGGTTAGAATATCTTATCTAAGATATATGAGAGATATGTGTGAGGATTTAATGGGATTATATTTTGTAATAATGGGAAATAGGTTGAGAGAATAGTGGATCTGTAATAATGAGATGGTTATCTTATCTTCAAGGCTCTCATGTATAAAAGAGAGTGCTCTCTCTTCATGAGAATTCAATTAGGGATTAGATCATTAGAATGAAGATTAGATTTTGATTAGCTTTTGATGAAGGAAGGGGATTCTTAGCTTGGTTTCATTGATTCATACTTTCATTATTGTTTCATGAAGATTGATTTGATTCTTGTAATGTAATTCAACATGGTCTTaaaaaaaaaaaaaaaa


Protein sequences

Name Description Sequence
Psi.12642 translated coding region predicted by ESTScan from UniGene Psi.12642

XMEEEEVGVICNCAFNKNATCHVIQIKVRYEEMTGIIPPEMANLTYLENIDLRYNLLHGSIPASLGSLTSLQYLLFGRNNLSGEIPKEWGKLTNLLVLGFGQNYLSGTIPPELGNLTKLEQLIMW


Domains

Domain Start-End Description Sequence

Gene3D: G3DSA:3.80.10.10
21-122 no description

CHVIQIKVRYEEMTGIIPPEMANLTYLENIDLRYNLLHGSIPASLGSLTSLQYLLFGRNNLSGEIPKEWGKLTNLLVLGFGQNYLSGTIPPELGNLTKLEQL

HMMPanther: PTHR24420:SF469
21-122 SUBFAMILY NOT NAMED,SUBFAMILY NOT NAMED

CHVIQIKVRYEEMTGIIPPEMANLTYLENIDLRYNLLHGSIPASLGSLTSLQYLLFGRNNLSGEIPKEWGKLTNLLVLGFGQNYLSGTIPPELGNLTKLEQL

HMMPanther: PTHR24420
21-122 FAMILY NOT NAMED,FAMILY NOT NAMED

CHVIQIKVRYEEMTGIIPPEMANLTYLENIDLRYNLLHGSIPASLGSLTSLQYLLFGRNNLSGEIPKEWGKLTNLLVLGFGQNYLSGTIPPELGNLTKLEQL

superfamily: SSF52058
22-124 L domain-like,LRR

HVIQIKVRYEEMTGIIPPEMANLTYLENIDLRYNLLHGSIPASLGSLTSLQYLLFGRNNLSGEIPKEWGKLTNLLVLGFGQNYLSGTIPPELGNLTKLEQLIM

HMMPfam: PF00560
IPR001611
47-68 LRR_1
Leucine-rich repeat

LENIDLRYNLLHGSIPASLGSL

HMMPfam: PF00560
IPR001611
70-91 LRR_1
Leucine-rich repeat

SLQYLLFGRNNLSGEIPKEWGK






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox