PRGDB00074866 (Pta.13937)

From PRG Wiki
Jump to: navigation, search
Pta.13937
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 70782054 (DR691702)
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Pinus taeda

Comment?

EST1081789 Normalized pine embryo library, Lib_D Pinus taeda cDNA clone PWADB77 3' end, mRNA sequence

DNA Sequence

GGCATTTCAAAAAGAGCTGGACATAGAAGGATTTTGGTATTTGAAAAGCATTCACTCGTCCCACGATGATGTATTGCCCAATCCAGAATGTTTTATGGTTCAGGTGGTCCATATGCCTTGTTTACAGAGAAATATACTAGCCGAGCCTTGGCAAAGATGTCTTTTGAAGAAAAGGACTTAACCGAGGATACTGAAGATTGGTAGAAGCGTTACTCCCTATTACTTGGAGTTACTCCATCATACTTGGAGTAACCCGAGGGATTCTTTACTTGCATGAGGATTCTCATCTCCAGATTATTCATCGGGATATTAAAGCAAACAACATTTTGCTGGACAAAAATTTGAATCCCAAGATAACAGATTTCGGACTAGCCAGACTATTTGAGGACTATCAAACTTGTGTTGGGACAAGAGTTGCTAGCACTCGTGGTTACATGGCACCGGAGTATGCTATGCATGAGCATTTGTCTGCCAAAGCCGATGACTATAGCTCTGGGATTCCTCTTCTGGAACTTATGAGTGGAAGAAAGGACATGGATTTTATATTATCACCTGAAACCCAGATCCTTTTAGAATGGGCATGGGGACTATACCAAAGAGGAAATATGGAGGACGTTATTGATCCAGTTATAAACAAAACCTGCAGCGATCAGGAACATGTCTTGAGATGCATCCAGGTTGGACTGTTCTGTACAGAAGCCCGCGCATCACTGTCTACATTCAACTTGATGCTTTCAACTGACGCTATGATGTTAGCAGACCCCACAAAACCTACTTTTGTGAGTTCTGTAGCTACCCACAACACCGAATACACCAGCAATCCTGGCTCACCAAATCATGGTTCATCGCATACGTCTGCAACCAT


Protein sequences

Name Description Sequence
Pta.13937 translated coding region predicted by ESTScan from UniGene Pta.13937

GISKRAGHRRILVFEKHSLVPRXCIAQSRMFYGSGGPYALFTEKYTSRALAKMSFEEKDLTEDTEDXVEALLPITWSYSIILGVTRGILYLHEDSHLQIIHRDIKANNILLDKNLNPKITDFGLARLFEDYQTCVGTRVASTRGYMAPEYAMHEHLSAKADDYSSGIPLLELMSGRKDMDFILSPETQILLEWAWGLYQRGNMEDVIDPVINKTCSDQEHVLRCIQVGLFCTEARASLSTFNLMLSTDAMMLADPTKPTFVSSVATHNTEYTSNPGSPNHGSSHTSATX

Domains

Domain Start-End Description Sequence

ProfileScan: PS50011
IPR000719
1-230 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

GISKRAGHRRILVFEKHSLVPRXCIAQSRMFYGSGGPYALFTEKYTSRALAKMSFEEKDLTEDTEDXVEALLPITWSYSIILGVTRGILYLHEDSHLQIIHRDIKANNILLDKNLNPKITDFGLARLFEDYQTCVGTRVASTRGYMAPEYAMHEHLSAKADDYSSGIPLLELMSGRKDMDFILSPETQILLEWAWGLYQRGNMEDVIDPVINKTCSDQEHVLRCIQVGLF

HMMSmart: SM00220
IPR002290
1-211 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

GISKRAGHRRILVFEKHSLVPRXCIAQSRMFYGSGGPYALFTEKYTSRALAKMSFEEKDLTEDTEDXVEALLPITWSYSIILGVTRGILYLHEDSHLQIIHRDIKANNILLDKNLNPKITDFGLARLFEDYQTCVGTRVASTRGYMAPEYAMHEHLSAKADDYSSGIPLLELMSGRKDMDFILSPETQILLEWAWGLYQRGNMEDVIDPVI

HMMSmart: SM00219
IPR020635
13-210 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

VFEKHSLVPRXCIAQSRMFYGSGGPYALFTEKYTSRALAKMSFEEKDLTEDTEDXVEALLPITWSYSIILGVTRGILYLHEDSHLQIIHRDIKANNILLDKNLNPKITDFGLARLFEDYQTCVGTRVASTRGYMAPEYAMHEHLSAKADDYSSGIPLLELMSGRKDMDFILSPETQILLEWAWGLYQRGNMEDVIDPV

Gene3D: G3DSA:3.10.120.10
IPR001199
27-67 no description
Cytochrome b5

QSRMFYGSGGPYALFTEKYTSRALAKMSFEEKDLTEDTEDX

Seg: seg
56-72 seg

EEKDLTEDTEDXVEALL

Gene3D: G3DSA:1.10.510.10
72-199 no description

LPITWSYSIILGVTRGILYLHEDSHLQIIHRDIKANNILLDKNLNPKITDFGLARLFEDYQTCVGTRVASTRGYMAPEYAMHEHLSAKADDYSSGIPLLELMSGRKDMDFILSPETQILLEWAWGLYQ

superfamily: SSF56112
IPR011009
72-245 Protein kinase-like (PK-like)
Protein kinase-like domain

LPITWSYSIILGVTRGILYLHEDSHLQIIHRDIKANNILLDKNLNPKITDFGLARLFEDYQTCVGTRVASTRGYMAPEYAMHEHLSAKADDYSSGIPLLELMSGRKDMDFILSPETQILLEWAWGLYQRGNMEDVIDPVINKTCSDQEHVLRCIQVGLFCTEARASLSTFNLML

HMMPanther: PTHR24420:SF430
78-261 SUBFAMILY NOT NAMED,SUBFAMILY NOT NAMED

YSIILGVTRGILYLHEDSHLQIIHRDIKANNILLDKNLNPKITDFGLARLFEDYQTCVGTRVASTRGYMAPEYAMHEHLSAKADDYSSGIPLLELMSGRKDMDFILSPETQILLEWAWGLYQRGNMEDVIDPVINKTCSDQEHVLRCIQVGLFCTEARASLSTFNLMLSTDAMMLADPTKPTFV

HMMPanther: PTHR24420
78-261 FAMILY NOT NAMED,FAMILY NOT NAMED

YSIILGVTRGILYLHEDSHLQIIHRDIKANNILLDKNLNPKITDFGLARLFEDYQTCVGTRVASTRGYMAPEYAMHEHLSAKADDYSSGIPLLELMSGRKDMDFILSPETQILLEWAWGLYQRGNMEDVIDPVINKTCSDQEHVLRCIQVGLFCTEARASLSTFNLMLSTDAMMLADPTKPTFV

HMMPfam: PF00069
IPR017442
79-176 Pkinase,Ser-thr
Serine/threonine-protein kinase-like domain

SIILGVTRGILYLHEDSHLQIIHRDIKANNILLDKNLNPKITDFGLARLFEDYQTCVGTRVASTRGYMAPEYAMHEHLSAKADDYSSGIPLLELMSGR

PatternScan: PS00108
IPR008271
99-111 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

IIHRDIKANNILL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox