PRGDB00075088 (Pth.475)

From PRG Wiki
Jump to: navigation, search
Pth.475
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 118486466 (EF147037)
Gene Class Unknown
Domain Type LRR
Gene Species Populus trichocarpa

Comment?

Populus trichocarpa clone WS01226_J06 unknown mRNA

DNA Sequence

GGCAAGCTAAAGTAGTAATGGCTAAGCTTCATCTTAAGCTCTTTCCTAAGCTTGTTTCCTCTCTTGCCGTTCTTCTTCTTTGTCAATTTGGCTATGTAGTTTGTCAATCAACAGGTTTCTCTGACAGCCGGTTGCCTGCAGATGAAGAAAAGGCTTTGGATGACTTGTTGAAAACGTTAGAGTGGGGTTTTCATCCAAATATCTCACGCTCGGCTTGTTCCTCTAATTTTGAATACATCAAATGCGATTGCAACAGAACAGTTTGTCATGTCACTCGCCTAACGCTCCCAGACCAGGACTTAACTGGACAGATAAATGCTGAAGCCTTGGCTAGTCTCGTTCACCTAAGAGCAATTGATTTGTCCAAGAATCAACTTCATGGTAGCATCCCTCTCACCTTGGGGAACTTGAGTTCACTCACCCGTCTCGATCTCTCCACAAACTTCCTCAATGGCTACATACCTTCATCCTTGGGGAATTTGTCGTCCCTTCAATATCTCCGTCTCTCGAGAAACTTCCTCAATGACTTCATACCTTCATCTTTGGGGAATTTGTCGTCCCTCGAATATCTGAGTTTGTCGTATAATAAGTTATTTGGTCAAATCCCTAAAGAATTGGGCAACCTCTCTAATCTCCTATCTATGTACTTGGACTTCAATGAACTCACTGGTCAGCTTCCACCAGAACTTGGAAGATTGGGATCTCTTGGTTATTTAGGGTTGAGCTCCAACAATTTGAGTGGACCACTGCCGGAAAATTATGCCAACTTTACGGGATTGCAGTGGTTTAGCGTAGCTGGGAACCGTTTGACCGGTCAAGTACCAAGTTTCATTGCGGATTGGACTGAACTCAATAGGCTGTCCCTCTCCGGGAATGATTTTGAAAGGGAGCTGCCTCTTGAAAGTATTTTTAACATGTCAAATCTCCGATACTTGTTTGTTAGTGATGTAAGAAGCTCCGGTTTCCCAAAAAATGCAAATATGAAGAAAATAAGATACCTGATGATAAGGAATTGCTCAATAAGTGGTGAAATCCCCCCGTACATTGGTGATTGGTCAAGGTTAAGATACCTAGACTTGAGCTTTAACAGCTTAACTGGTGGAATACCAGATTCCATGAAAAAGCTGAATTTAAGTAAGATGTTTCTTACAGGAAATATGCTTAATGGCACTGTACCTTACTGGGTTCCTGATACCATTGAAGACAAGGCGGACTTGTCATATAATAATTTTGAAATTCCACGTGATGGTCCGAAGaaaaaaaaaaaaaaaa


Protein sequences

Name Description Sequence
Pth.475 translated coding region predicted by ESTScan from UniGene Pth.475

XQAKVVMAKLHLKLFPKLVSSLAVLLLCQFGYVVCQSTGFSDSRLPADEEKALDDLLKTLEWGFHPNISRSACSSNFEYIKCDCNRTVCHVTRLTLPDQDLTGQINAEALASLVHLRAIDLSKNQLHGSIPLTLGNLSSLTRLDLSTNFLNGYIPSSLGNLSSLQYLRLSRNFLNDFIPSSLGNLSSLEYLSLSYNKLFGQIPKELGNLSNLLSMYLDFNELTGQLPPELGRLGSLGYLGLSSNNLSGPLPENYANFTGLQWFSVAGNRLTGQVPSFIADWTELNRLSLSGNDFERELPLESIFNMSNLRYLFVSDVRSSGFPKNANMKKIRYLMIRNCSISGEIPPYIGDWSRLRYLDLSFNSLTGGIPDSMKKLNLSKMFLTGNMLNGTVPYWVPDTIEDKAXLVI


Domains

Domain Start-End Description Sequence

HMMPanther: PTHR24420
22-393 FAMILY NOT NAMED,FAMILY NOT NAMED

LAVLLLCQFGYVVCQSTGFSDSRLPADEEKALDDLLKTLEWGFHPNISRSACSSNFEYIKCDCNRTVCHVTRLTLPDQDLTGQINAEALASLVHLRAIDLSKNQLHGSIPLTLGNLSSLTRLDLSTNFLNGYIPSSLGNLSSLQYLRLSRNFLNDFIPSSLGNLSSLEYLSLSYNKLFGQIPKELGNLSNLLSMYLDFNELTGQLPPELGRLGSLGYLGLSSNNLSGPLPENYANFTGLQWFSVAGNRLTGQVPSFIADWTELNRLSLSGNDFERELPLESIFNMSNLRYLFVSDVRSSGFPKNANMKKIRYLMIRNCSISGEIPPYIGDWSRLRYLDLSFNSLTGGIPDSMKKLNLSKMFLTGNMLNGTVP

Gene3D: G3DSA:3.80.10.10
73-286 no description

CSSNFEYIKCDCNRTVCHVTRLTLPDQDLTGQINAEALASLVHLRAIDLSKNQLHGSIPLTLGNLSSLTRLDLSTNFLNGYIPSSLGNLSSLQYLRLSRNFLNDFIPSSLGNLSSLEYLSLSYNKLFGQIPKELGNLSNLLSMYLDFNELTGQLPPELGRLGSLGYLGLSSNNLSGPLPENYANFTGLQWFSVAGNRLTGQVPSFIADWTELNR

superfamily: SSF52047
93-408 RNI-like,LRR

RLTLPDQDLTGQINAEALASLVHLRAIDLSKNQLHGSIPLTLGNLSSLTRLDLSTNFLNGYIPSSLGNLSSLQYLRLSRNFLNDFIPSSLGNLSSLEYLSLSYNKLFGQIPKELGNLSNLLSMYLDFNELTGQLPPELGRLGSLGYLGLSSNNLSGPLPENYANFTGLQWFSVAGNRLTGQVPSFIADWTELNRLSLSGNDFERELPLESIFNMSNLRYLFVSDVRSSGFPKNANMKKIRYLMIRNCSISGEIPPYIGDWSRLRYLDLSFNSLTGGIPDSMKKLNLSKMFLTGNMLNGTVPYWVPDTIEDKAXLVI

HMMSmart: SM00369
IPR003591
113-136 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

LVHLRAIDLSKNQLHGSIPLTLGN

HMMPfam: PF00560
IPR001611
115-137 LRR_1
Leucine-rich repeat

HLRAIDLSKNQLHGSIPLTLGNL

FPrintScan: PR00019
116-129 LEURICHRPT,Leucine-rich repeat signature

LRAIDLSKNQLHGS

HMMSmart: SM00369
IPR003591
137-160 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

LSSLTRLDLSTNFLNGYIPSSLGN

HMMPfam: PF13855
138-198 LRR_8,Leucine rich repeat

SSLTRLDLSTNFLNGYIPSSLGNLSSLQYLRLSRNFLNDFIPSSLGNLSSLEYLSLSYNKL

HMMSmart: SM00369
IPR003591
161-184 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

LSSLQYLRLSRNFLNDFIPSSLGN

Seg: seg
180-198 seg

SSLGNLSSLEYLSLSYNKL

FPrintScan: PR00019
185-198 LEURICHRPT,Leucine-rich repeat signature

LSSLEYLSLSYNKL

HMMSmart: SM00369
IPR003591
185-208 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

LSSLEYLSLSYNKLFGQIPKELGN

HMMSmart: SM00369
IPR003591
209-233 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

LSNLLSMYLDFNELTGQLPPELGRL

Seg: seg
230-251 seg

LGRLGSLGYLGLSSNNLSGPLP

Gene3D: G3DSA:3.80.10.10
287-391 no description

LSLSGNDFERELPLESIFNMSNLRYLFVSDVRSSGFPKNANMKKIRYLMIRNCSISGEIPPYIGDWSRLRYLDLSFNSLTGGIPDSMKKLNLSKMFLTGNMLNGT

HMMPfam: PF13855
330-388 LRR_8,Leucine rich repeat

KIRYLMIRNCSISGEIPPYIGDWSRLRYLDLSFNSLTGGIPDSMKKLNLSKMFLTGNML






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox