PRGDB00075146 (Pth.3283)

From PRG Wiki
Jump to: navigation, search
Pth.3283
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 118482069 (EF144747)
Gene Class Unknown
Domain Type LRR
Gene Species Populus trichocarpa

Comment?

Populus trichocarpa clone WS01117_L20 unknown mRNA

DNA Sequence

CGATCTCCATGCCCACACTTCACTCCCCAACGTAAACTCATaaaaaaaaGCATACACTCTACACGCAGAAATCAAGAAACAATGACAATGTTTTCTTACATTACATTACTAGCAACCTTAACAATATTCATCTCTACTTGTACAGTTCGAAGCTGTCCTCCTTCAGACAGGGCAGCTTTGCTAGCTTTCAAAGCAGCTCTCCACGAGCCTTACTTGGGCATCTTCAATTCTTGGGCGGGCACCGATTGTTGCCGTAACTGGTATGGTGTCAGCTGTGACATGGAGACCAAAAGGGTTGCTGACATTAACCTCCGAGGTGAATCTGAAGACCCCATTTTCCAAAAAGCTGGTCGGTCCGGGTACATGACTGGTTCGATCTCTCCTTCTATTTGCAAGCTCAAGAGGCTCTCCAGTCTTACAATTGCTGATTGGAAAGGGATCTCAGGTCCGATTCCAGCCTGCATTACGTCGTTGCCGTTCTTGAGGATTCTTGATTTGATTGGGAATCGGCTTTCAGGCCCGATTCCGGAAGACATCGGACGGTTGCACAGGCTGACCGTTTTGAATATCGCCGACAATCTTGTAACAAGTAGGATCCCGAGATCCTTGACTAATTTGTCGAGTTTGATGCATCTCGATTTGCGTAACAATCGGATTTGGGGTTCTTTGCCTCGAGATTTCGGGCGTCTTCGGATGTTGAGTCGTGCTTTATTGAGCCGAAATTATATTGGCGGGACAATTCCCGATTCAATTTCTAAAATTTATCGTCTCGCCGATTTGGATCTTTCCTTGAACAGATTATCGGGCGAAATACCAGCTTCTTTGGGTAAAATGGCAGTCTTGGCAACACTAAATCTTGATGCCAACAACTTATCAGGAAATATACCTTATAGTTTGTTTAATTCAGCTATTGGTAACTTGAATTTGAGCAAAAACTCATTTCATGGATATCTACCGGATGTTTTCGGTCCGGGATCTTACTTCATGGTTCTTGATCTATCCTACAATAACTTTTGGGGTCTGATACCAAAATCTTTGTCCCAAGCATCATTTATCGGGCACTTGGATTTGAGTCACAACCGCCTATGTGGGAGGATTCCAGCAGGTCCGCCTTTCGACCACCTCGAAGCATCATCGTTTGCTTATAATGCTTGTCTTTGCGGTAAGCCACTCGGAGCTTGCAGGTAGACGTACGAGACTATATGTTTCGGTCAGCCGAGATGGAAGTTAGTTTCATTTTTTCGGGATTGGTTAAATACCACATGTTTGTATGATTATGAAATGTAACAGTAAAGTGTGTTTAATTAGTAACGTCGTTAGGGGAATTAAAAAGGTTAATTTCATGCACGTAATCTTGCATGAAACCAAGCTTTGATGCAATGAGTGTAACTATAAACATAGATGTAATACCAGATTATGTCAAATCAAATGATAAAAGCAAATTAATGTTATTTTCTaaaaaagaaaaaaaaaaaaaaaa


Protein sequences

Name Description Sequence
Pth.3283 translated coding region predicted by ESTScan from UniGene Pth.3283

MTMFSYITLLATLTIFISTCTVRSCPPSDRAALLAFKAALHEPYLGIFNSWAGTDCCRNWYGVSCDMETKRVADINLRGESEDPIFQKAGRSGYMTGSISPSICKLKRLSSLTIADWKGISGPIPACITSLPFLRILDLIGNRLSGPIPEDIGRLHRLTVLNIADNLVTSRIPRSLTNLSSLMHLDLRNNRIWGSLPRDFGRLRMLSRALLSRNYIGGTIPDSISKIYRLADLDLSLNRLSGEIPASLGKMAVLATLNLDANNLSGNIPYSLFNSAIGNLNLSKNSFHGYLPDVFGPGSYFMVLDLSYNNFWGLIPKSLSQASFIGHLDLSHNRLCGRIPAGPPFDHLEASSFAYNACLCGKPLGACR


Domains

Domain Start-End Description Sequence

HMMPanther: PTHR24420
10-365 PTHR24420,FAMILY NOT NAMED

LATLTIFISTCTVRSCPPSDRAALLAFKAALHEPYLGIFNSWAGTDCCRNWYGVSCDMETKRVADINLRGESEDPIFQKAGRSGYMTGSISPSICKLKRLSSLTIADWKGISGPIPACITSLPFLRILDLIGNRLSGPIPEDIGRLHRLTVLNIADNLVTSRIPRSLTNLSSLMHLDLRNNRIWGSLPRDFGRLRMLSRALLSRNYIGGTIPDSISKIYRLADLDLSLNRLSGEIPASLGKMAVLATLNLDANNLSGNIPYSLFNSAIGNLNLSKNSFHGYLPDVFGPGSYFMVLDLSYNNFWGLIPKSLSQASFIGHLDLSHNRLCGRIPAGPPFDHLEASSFAYNACLCGKPLG

HMMPanther: PTHR24420:SF645
10-365 PTHR24420:SF645

LATLTIFISTCTVRSCPPSDRAALLAFKAALHEPYLGIFNSWAGTDCCRNWYGVSCDMETKRVADINLRGESEDPIFQKAGRSGYMTGSISPSICKLKRLSSLTIADWKGISGPIPACITSLPFLRILDLIGNRLSGPIPEDIGRLHRLTVLNIADNLVTSRIPRSLTNLSSLMHLDLRNNRIWGSLPRDFGRLRMLSRALLSRNYIGGTIPDSISKIYRLADLDLSLNRLSGEIPASLGKMAVLATLNLDANNLSGNIPYSLFNSAIGNLNLSKNSFHGYLPDVFGPGSYFMVLDLSYNNFWGLIPKSLSQASFIGHLDLSHNRLCGRIPAGPPFDHLEASSFAYNACLCGKPLG

superfamily: SSF52058
23-368 SSF52058,LRR

RSCPPSDRAALLAFKAALHEPYLGIFNSWAGTDCCRNWYGVSCDMETKRVADINLRGESEDPIFQKAGRSGYMTGSISPSICKLKRLSSLTIADWKGISGPIPACITSLPFLRILDLIGNRLSGPIPEDIGRLHRLTVLNIADNLVTSRIPRSLTNLSSLMHLDLRNNRIWGSLPRDFGRLRMLSRALLSRNYIGGTIPDSISKIYRLADLDLSLNRLSGEIPASLGKMAVLATLNLDANNLSGNIPYSLFNSAIGNLNLSKNSFHGYLPDVFGPGSYFMVLDLSYNNFWGLIPKSLSQASFIGHLDLSHNRLCGRIPAGPPFDHLEASSFAYNACLCGKPLGACR

Gene3D: G3DSA:3.80.10.10
25-341 G3DSA:3.80.10.10

CPPSDRAALLAFKAALHEPYLGIFNSWAGTDCCRNWYGVSCDMETKRVADINLRGESEDPIFQKAGRSGYMTGSISPSICKLKRLSSLTIADWKGISGPIPACITSLPFLRILDLIGNRLSGPIPEDIGRLHRLTVLNIADNLVTSRIPRSLTNLSSLMHLDLRNNRIWGSLPRDFGRLRMLSRALLSRNYIGGTIPDSISKIYRLADLDLSLNRLSGEIPASLGKMAVLATLNLDANNLSGNIPYSLFNSAIGNLNLSKNSFHGYLPDVFGPGSYFMVLDLSYNNFWGLIPKSLSQASFIGHLDLSHNRLCGRIPA

HMMPfam: PF08263
IPR013210
27-66 LRRNT_2
Leucine-rich repeat-containing N-terminal, type 2

PSDRAALLAFKAALHEPYLGIFNSWAGTDCCRNWYGVSCD

HMMPfam: PF13855
134-192 LRR_8,Leucine rich repeat

LRILDLIGNRLSGPIPEDIGRLHRLTVLNIADNLVTSRIPRSLTNLSSLMHLDLRNNRI

HMMPfam: PF00560
IPR001611
327-345 LRR_1
Leucine-rich repeat

HLDLSHNRLCGRIPAGPPF






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox