PRGDB00075170 (Pth.4618)

From PRG Wiki
Jump to: navigation, search
Pth.4618
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 224141610 (XM_002324124)
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Populus trichocarpa

Comment?

Populus trichocarpa predicted protein, mRNA

DNA Sequence

CTGAAAAACACTTCTCTCTCTAAAAATCTATTTCCAATGGCGATTGCTGCGGAGGCCCAGCCCCAAGAGAAGGCGAGAACAGATGTATCAGGGGCAGAGAAGAAGAGATGGACGCTTAACGATTTTGATATGGGAAAGCCACTTGGGCGTGGAAAGTTTGGTCATGTTTACTTAGCCAGAGAAAAAAGGAGCAATCATATTGTGGCTTTGAAGGTTCTGTTTAAGAGTCAGTTGCAACAGTCACAGGTTGAACATCAGCTCCGTCGCGAAGTTGAAATTCAGAGTCATCTTAGACATCCCAATATATTGCGCCTTTACGGTTACTTTTATGATCAGAAACGAGTTTATTTGATATTAGAATATGCAGCCAAAGGTGAACTCTACAAAGAATTGCAGAGGTGTAAATACTTTAGCGAAAGACGTGCTGCTACTTATGTTGCGTCATTAGCCAGGGCACTGATTTATTGTCACAGCAAGCATGTGATACACAGAGACATCAAGCCAGAGAACCTGTTAATTGGTGCACAGGGTGAGCTCAAGATTGCAGACTTTGGTTGGTCAGTGCACACTTTTAACCGCAGGCGTACGATGTGTGGTACATTGGACTACCTCCCACCAGAGATGGTGCAAAGTGTAGAGCATGATGCTAGTGTTGATATATGGAGCCTGGGTGTTTTATGCTATGAGTTTTTATATGGCATCCCCCCGTTTGAGGCCAAGGAACACTCAGACACATACAAAAGGATTGTGCAAGTGGATCTGAAGTTCCCTCCTAAACCAATTGTCTCTTCTGCTGCAAAGGACCTTATTAGTCAGATGCTTGTCAAGGATTCTGTTGAGCGACTACCATTACATAAGCTGCTTGAGCATCCCTGGATCGTTCAAAATGTTGATCCCTCTGGCATCTTTAGGGGTTGAATTGTCTTTATAAGATGCTTTACTACTTCAGGGGAATCAATGGTGTGAGATTTTGGAGAAGAACATGAAGAACCTTTGGCAAGGTCTATGAATTTGTGAAGAACCGGATCACAGTATGACTTGTATGAGTTAATTGCCCATGTTGTCTCCAAGCTCTGGTGAACAAAAAAACATTGGTTTATTATGTTAATATAGAGCCCATATTCTTTTCTTTTAA


Protein sequences

Name Description Sequence
Pth.4618 translated coding region predicted by ESTScan from UniGene Pth.4618

LKNTSLSKNLFPMAIAAEAQPQEKARTDVSGAEKKRWTLNDFDMGKPLGRGKFGHVYLAREKRSNHIVALKVLFKSQLQQSQVEHQLRREVEIQSHLRHPNILRLYGYFYDQKRVYLILEYAAKGELYKELQRCKYFSERRAATYVASLARALIYCHSKHVIHRDIKPENLLIGAQGELKIADFGWSVHTFNRRRTMCGTLDYLPPEMVQSVEHDASVDIWSLGVLCYEFLYGIPPFEAKEHSDTYKRIVQVDLKFPPKPIVSSAAKDLISQMLVKDSVERLPLHKLLEHPWIVQNVDPSGIFRG

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR24350
17-296 FAMILY NOT NAMED,SERINE/THREONINE-PROTEIN KINASE IAL-RELATED

AEAQPQEKARTDVSGAEKKRWTLNDFDMGKPLGRGKFGHVYLAREKRSNHIVALKVLFKSQLQQSQVEHQLRREVEIQSHLRHPNILRLYGYFYDQKRVYLILEYAAKGELYKELQRCKYFSERRAATYVASLARALIYCHSKHVIHRDIKPENLLIGAQGELKIADFGWSVHTFNRRRTMCGTLDYLPPEMVQSVEHDASVDIWSLGVLCYEFLYGIPPFEAKEHSDTYKRIVQVDLKFPPKPIVSSAAKDLISQMLVKDSVERLPLHKLLEHPWIVQN

Gene3D: G3DSA:3.30.200.20
18-139 no description

EAQPQEKARTDVSGAEKKRWTLNDFDMGKPLGRGKFGHVYLAREKRSNHIVALKVLFKSQLQQSQVEHQLRREVEIQSHLRHPNILRLYGYFYDQKRVYLILEYAAKGELYKELQRCKYFSE

superfamily: SSF56112
IPR011009
28-300 Protein kinase-like (PK-like)
Protein kinase-like domain

DVSGAEKKRWTLNDFDMGKPLGRGKFGHVYLAREKRSNHIVALKVLFKSQLQQSQVEHQLRREVEIQSHLRHPNILRLYGYFYDQKRVYLILEYAAKGELYKELQRCKYFSERRAATYVASLARALIYCHSKHVIHRDIKPENLLIGAQGELKIADFGWSVHTFNRRRTMCGTLDYLPPEMVQSVEHDASVDIWSLGVLCYEFLYGIPPFEAKEHSDTYKRIVQVDLKFPPKPIVSSAAKDLISQMLVKDSVERLPLHKLLEHPWIVQNVDPS

ProfileScan: PS50011
IPR000719
42-293 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

FDMGKPLGRGKFGHVYLAREKRSNHIVALKVLFKSQLQQSQVEHQLRREVEIQSHLRHPNILRLYGYFYDQKRVYLILEYAAKGELYKELQRCKYFSERRAATYVASLARALIYCHSKHVIHRDIKPENLLIGAQGELKIADFGWSVHTFNRRRTMCGTLDYLPPEMVQSVEHDASVDIWSLGVLCYEFLYGIPPFEAKEHSDTYKRIVQVDLKFPPKPIVSSAAKDLISQMLVKDSVERLPLHKLLEHPWI

HMMSmart: SM00219
IPR020635
42-288 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

FDMGKPLGRGKFGHVYLAREKRSNHIVALKVLFKSQLQQSQVEHQLRREVEIQSHLRHPNILRLYGYFYDQKRVYLILEYAAKGELYKELQRCKYFSERRAATYVASLARALIYCHSKHVIHRDIKPENLLIGAQGELKIADFGWSVHTFNRRRTMCGTLDYLPPEMVQSVEHDASVDIWSLGVLCYEFLYGIPPFEAKEHSDTYKRIVQVDLKFPPKPIVSSAAKDLISQMLVKDSVERLPLHKLL

HMMSmart: SM00220
IPR002290
42-293 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

FDMGKPLGRGKFGHVYLAREKRSNHIVALKVLFKSQLQQSQVEHQLRREVEIQSHLRHPNILRLYGYFYDQKRVYLILEYAAKGELYKELQRCKYFSERRAATYVASLARALIYCHSKHVIHRDIKPENLLIGAQGELKIADFGWSVHTFNRRRTMCGTLDYLPPEMVQSVEHDASVDIWSLGVLCYEFLYGIPPFEAKEHSDTYKRIVQVDLKFPPKPIVSSAAKDLISQMLVKDSVERLPLHKLLEHPWI

HMMPfam: PF00069
IPR017442
44-293 Pkinase,Ser-thr
Serine/threonine-protein kinase-like domain

MGKPLGRGKFGHVYLAREKRSNHIVALKVLFKSQLQQSQVEHQLRREVEIQSHLRHPNILRLYGYFYDQKRVYLILEYAAKGELYKELQRCKYFSERRAATYVASLARALIYCHSKHVIHRDIKPENLLIGAQGELKIADFGWSVHTFNRRRTMCGTLDYLPPEMVQSVEHDASVDIWSLGVLCYEFLYGIPPFEAKEHSDTYKRIVQVDLKFPPKPIVSSAAKDLISQMLVKDSVERLPLHKLLEHPWI

PatternScan: PS00107
IPR017441
48-71 PROTEIN_KINASE_ATP
Protein kinase, ATP binding site

LGRGKFGHVYLAREKRSNHIVALK

Gene3D: G3DSA:1.10.510.10
140-297 no description

RRAATYVASLARALIYCHSKHVIHRDIKPENLLIGAQGELKIADFGWSVHTFNRRRTMCGTLDYLPPEMVQSVEHDASVDIWSLGVLCYEFLYGIPPFEAKEHSDTYKRIVQVDLKFPPKPIVSSAAKDLISQMLVKDSVERLPLHKLLEHPWIVQNV

PatternScan: PS00108
IPR008271
161-173 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

VIHRDIKPENLLI






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox