PRGDB00075172 (Pth.4633)

From PRG Wiki
Jump to: navigation, search
Pth.4633
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 224100246 (XM_002311765)
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Populus trichocarpa

Comment?

Populus trichocarpa predicted protein, mRNA

DNA Sequence

TTGTTGTCTGTCTCAATGGTTTCCACAGTTTGATTATTTTTAAAAATCTTTAAAAAGGGGCTATCAATTTTTATGTACCTGACGTGATCTAGCCCTTCTTTTCTGTTTTTCAATTGGGGTTGTGGGTATTGAAGAGAAATTGCTAAATTTGAAACCTCTTTTTTTGGATGTGGCAAGTGGTGGGATTTGGGGTGTTGGTTTGATGAAAAGTGGGTTTTGGAATTTAGGGTTTTTGAAGAGGAAAGGAGAGGATGGGTTTAGGCAGTGAAGAAGGTAAAGTGAAGTCTTCTTGGGATGTGTGCAAATCAAAGGAGAGGAAGAAGAAAGATGGTACAAAGGCGGGGTGTTGGGTCAAGTTAAGGCTTGTTGGGGGCTGCATTTCGTCAAGATCCAAAGTTGATAGCTCTGTTAGTGGGACTATTTGTGAATCAACAGAAAGTAAATCCATAAATGATACAAGCACAGACCAACCAGCTGTTCCTGTTGTCTCATCGTCAACCACAAGCAATACAGAAAGTAATTCATCCCTTTCCAAACTTGAAGAGGAGCTTAAAGTTGCTTCTCGACTGCGGAAGTTCACATTTAATGATCTCAAACTGGCAACTCGAAATTTTAGACCTGAGAGTCTTCTTGGTGAAGGTGGCTTTGGTTGTGTTTTCAAGGGATGGATTGAAGAAAATGGAACTGCTCCGGTGAAACCTGGTACTGGCCTTACCGTTGCTGTTAAAACCCTTAATCATGATGGGCTCCAGGGTCATAAAGAATGGCTGGCTGAAGTAAATTACCTTGGTGATCTTGTTCATCCTAACCTGGTTAAACTGATTGGTTACTGCATTGAAGATGATCAAAGGCTGCTAGTTTACGAGTTCATGCCTCGAGGAAGCTTGGAGAACCACCTATTTCGACGGTCCCTACCTCTTCCATGGTCTATAAGAATGAAAATCGCTCTCGGTGCTGCCAAAGGTCTTGCCTTTCTTCATGAAGAAGCTGAAAGGCCAGTGATTTATCGTGATTTCAAAACCTCCAATATATTATTAGATGCGGATTACAATGCCAAGCTTTCTGATTTTGGACTTGCCAAAGATGCTCCCGAGGGAGATAAGACCCATGTATCAACCCGGGTGATGGGAACTTATGGTTATGCAGCCCCAGAGTATGTAATGACCGGACATCTTACATCAAGGAGCGACGTCTACAGTTTTGGTGTGGTCTTGCTTGAAATGATAACCGGCAGGAGATCCATGGATAAGAACCGTCCTAATGGAGAGCATAATCTTGTTGAGTGGGCGAGGCCATATCTAGGAGAGAGAAGAAGATTCTACCGGCTGATAGACCCTCGACTTCAAGGTCACTTTTCAATAAAAGGAGCCCAGAAAGCTGCACAGCTGGCTGCTCATTGCCTTAGCAGGGATCCTAAAGCCAGGCCTCTAATGAGTGAAGTGGTCGACACATTGAAGCCTCTGCCCAACCTCAAGGACATGGCAAGCTCATCGTATTATTTCCAGACCATGCAAGGTGACCGGGTTGGGTCTAGCCCAAATGCCAAAAATGGTGTCCGCTCACAGGCTGGATTGTTATCTCGGAATGGGCACCAACAAAGGAGTTTTTCAATACCACATGGTCCCCATGCTTCTCCTTTCCACCATCAATATCCCCACCAATCTCCAAAACCCAGTGGCAAACCATAGCACAGGATCAGTGAAGTAtctgcttcttttagctgcctcttttcattcatttcttttttcacccttttcttACTATAGATGTATTTTCTGTGAAAGCATTTGTTCTTGTACAACTGAGAAGGCAATGGAGGAACATGTCCCTATATGTTGTATTTAGAATGATGACCATCCTTCACACACGGGGTAATGATGAGGCTTATGGCGCAAAATGTTAGTCGATTGCCCTCTACAGTCCAGAAAATGTTAAGGAATATTAGGTCCTGTCTGATTGAATCTTTTTTCATAACTCGATCGGAAAAATCCGATTGGGATTGTTTCCATGTTCCATAATAACTCGACGTTATTCAGCCGGACAGGTATAAATTGCCTCTTTCAATCAACAAAAAATGGTGAGAAGGGTGGTTAAAAGA


Protein sequences

Name Description Sequence
Pth.4633 translated coding region predicted by ESTScan from UniGene Pth.4633

MGLGSEEGKVKSSWDVCKSKERKKKDGTKAGCWVKLRLVGGCISSRSKVDSSVSGTICESTESKSINDTSTDQPAVPVVSSSTTSNTESNSSLSKLEEELKVASRLRKFTFNDLKLATRNFRPESLLGEGGFGCVFKGWIEENGTAPVKPGTGLTVAVKTLNHDGLQGHKEWLAEVNYLGDLVHPNLVKLIGYCIEDDQRLLVYEFMPRGSLENHLFRRSLPLPWSIRMKIALGAAKGLAFLHEEAERPVIYRDFKTSNILLDADYNAKLSDFGLAKDAPEGDKTHVSTRVMGTYGYAAPEYVMTGHLTSRSDVYSFGVVLLEMITGRRSMDKNRPNGEHNLVEWARPYLGERRRFYRLIDPRLQGHFSIKGAQKAAQLAAHCLSRDPKARPLMSEVVDTLKPLPNLKDMASSSYYFQTMQGDRVGSSPNAKNGVRSQAGLLSRNGHQQRSFSIPHGPHASPFHHQYPHQSPKPSGKP

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR24420:SF661
86-469 PTHR24420:SF661

NTESNSSLSKLEEELKVASRLRKFTFNDLKLATRNFRPESLLGEGGFGCVFKGWIEENGTAPVKPGTGLTVAVKTLNHDGLQGHKEWLAEVNYLGDLVHPNLVKLIGYCIEDDQRLLVYEFMPRGSLENHLFRRSLPLPWSIRMKIALGAAKGLAFLHEEAERPVIYRDFKTSNILLDADYNAKLSDFGLAKDAPEGDKTHVSTRVMGTYGYAAPEYVMTGHLTSRSDVYSFGVVLLEMITGRRSMDKNRPNGEHNLVEWARPYLGERRRFYRLIDPRLQGHFSIKGAQKAAQLAAHCLSRDPKARPLMSEVVDTLKPLPNLKDMASSSYYFQTMQGDRVGSSPNAKNGVRSQAGLLSRNGHQQRSFSIPHGPHASPFHHQYPH

HMMPanther: PTHR24420
86-469 PTHR24420,FAMILY NOT NAMED

NTESNSSLSKLEEELKVASRLRKFTFNDLKLATRNFRPESLLGEGGFGCVFKGWIEENGTAPVKPGTGLTVAVKTLNHDGLQGHKEWLAEVNYLGDLVHPNLVKLIGYCIEDDQRLLVYEFMPRGSLENHLFRRSLPLPWSIRMKIALGAAKGLAFLHEEAERPVIYRDFKTSNILLDADYNAKLSDFGLAKDAPEGDKTHVSTRVMGTYGYAAPEYVMTGHLTSRSDVYSFGVVLLEMITGRRSMDKNRPNGEHNLVEWARPYLGERRRFYRLIDPRLQGHFSIKGAQKAAQLAAHCLSRDPKARPLMSEVVDTLKPLPNLKDMASSSYYFQTMQGDRVGSSPNAKNGVRSQAGLLSRNGHQQRSFSIPHGPHASPFHHQYPH

superfamily: SSF56112
IPR011009
91-409 Kinase_like
Protein kinase-like domain

SSLSKLEEELKVASRLRKFTFNDLKLATRNFRPESLLGEGGFGCVFKGWIEENGTAPVKPGTGLTVAVKTLNHDGLQGHKEWLAEVNYLGDLVHPNLVKLIGYCIEDDQRLLVYEFMPRGSLENHLFRRSLPLPWSIRMKIALGAAKGLAFLHEEAERPVIYRDFKTSNILLDADYNAKLSDFGLAKDAPEGDKTHVSTRVMGTYGYAAPEYVMTGHLTSRSDVYSFGVVLLEMITGRRSMDKNRPNGEHNLVEWARPYLGERRRFYRLIDPRLQGHFSIKGAQKAAQLAAHCLSRDPKARPLMSEVVDTLKPLPNLKD

Gene3D: G3DSA:3.30.200.20
102-193 G3DSA:3.30.200.20

VASRLRKFTFNDLKLATRNFRPESLLGEGGFGCVFKGWIEENGTAPVKPGTGLTVAVKTLNHDGLQGHKEWLAEVNYLGDLVHPNLVKLIGY

ProfileScan: PS50011
IPR000719
121-407 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

FRPESLLGEGGFGCVFKGWIEENGTAPVKPGTGLTVAVKTLNHDGLQGHKEWLAEVNYLGDLVHPNLVKLIGYCIEDDQRLLVYEFMPRGSLENHLFRRSLPLPWSIRMKIALGAAKGLAFLHEEAERPVIYRDFKTSNILLDADYNAKLSDFGLAKDAPEGDKTHVSTRVMGTYGYAAPEYVMTGHLTSRSDVYSFGVVLLEMITGRRSMDKNRPNGEHNLVEWARPYLGERRRFYRLIDPRLQGHFSIKGAQKAAQLAAHCLSRDPKARPLMSEVVDTLKPLPNL

HMMPfam: PF00069
IPR017442
124-399 Pkinase,Ser-thr
Serine/threonine-protein kinase-like domain

ESLLGEGGFGCVFKGWIEENGTAPVKPGTGLTVAVKTLNHDGLQGHKEWLAEVNYLGDLVHPNLVKLIGYCIEDDQRLLVYEFMPRGSLENHLFRRSLPLPWSIRMKIALGAAKGLAFLHEEAERPVIYRDFKTSNILLDADYNAKLSDFGLAKDAPEGDKTHVSTRVMGTYGYAAPEYVMTGHLTSRSDVYSFGVVLLEMITGRRSMDKNRPNGEHNLVEWARPYLGERRRFYRLIDPRLQGHFSIKGAQKAAQLAAHCLSRDPKARPLMSEVVD

PatternScan: PS00107
IPR017441
127-159 PROTEIN_KINASE_ATP
Protein kinase, ATP binding site

LGEGGFGCVFKGWIEENGTAPVKPGTGLTVAVK

Gene3D: G3DSA:1.10.510.10
194-400 G3DSA:1.10.510.10

CIEDDQRLLVYEFMPRGSLENHLFRRSLPLPWSIRMKIALGAAKGLAFLHEEAERPVIYRDFKTSNILLDADYNAKLSDFGLAKDAPEGDKTHVSTRVMGTYGYAAPEYVMTGHLTSRSDVYSFGVVLLEMITGRRSMDKNRPNGEHNLVEWARPYLGERRRFYRLIDPRLQGHFSIKGAQKAAQLAAHCLSRDPKARPLMSEVVDT

PatternScan: PS00108
IPR008271
250-262 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

VIYRDFKTSNILL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox