PRGDB00075173 (Pth.4966)

From PRG Wiki
Jump to: navigation, search
Pth.4966
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 224065630 (XM_002301857)
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Populus trichocarpa

Comment?

Populus trichocarpa predicted protein, mRNA

DNA Sequence

GACTTTTGATAACTCTGAAAATTATCTCCTCGATAATATTAGGTTTCCTTGAATAGTTAATTTGGTTTCAGCTAGGTTGCTGGATTAATGGCGAAGAGAAGGCAGAGCAAGATATTATTGGATCGTGGAAGTGAGTTATTGGAGGAAAGGATCAGATTTTGTGATGGTAGATGTAGATCAAATCCTATCAGGAACTTCTCTGTTGATCAAATCTGCAGAGCCATACAAGACTTCCAAAAAATTCACCCCTTACAAAGCTGTATAGAATTTGAATGGAAAAAGGGAGTTCTAGATGGGCGTCTTGTTTTCATCAAGAGGTATGCAAGAGGCGGTCAAGAGGTCTACCGTGACATTGTGGTCTCGTCGCAGATGAGCAGTCACAACAATGTTCTCAAGCTATTAGGTTGTTGTTTGGAGATCCCAGAAGGCCCAGCTCTAGTTTATGAATATCCAGAGAATCGAAGTCTGGATAGACATATTCATTATGGATCATTACCTTGGGGAACCAGATTGAAAATTGCCAAGGAAATTGCAAATGCCGTGGCATATCTCCACACTGCATTTCCCAGGCCCATCATCCACAGAGACATAAAACCTGCAAATATCTTCCTCAACCAGAATTATGCTGCCAAGTTGTCCGATTTCTCTTTTTCCATATCAATTCCTGAAGGTGAATCGAAGGTTGGAGATGATCTTCTTGTTGGGACATTTGGTTTCTTGGACCCTGATTATACGATGACAAATTTTGTGACAGAGAAGACTGATGTCTTCAGCTTTGGGGTGCTGCTGCTCGTCCTTCTTACTGGACGAGCAACACGTCAAGGGGAAATCCATCTGATAGAGCATGTGAAACTCTTGGTTGAACAGGATCGGGTACATGAAGCTGTGGATCCTATGATTAGGGGAAACGGGGGAGAAGCAATTGATCAGCAACAACTGGAAGCATCCATTGAACTAGCCTTGAGATGCACCGATGATTCAGGAGAAGATAGGCCACTAATGATAGAAGTAGCAAAAGAAATCCAGCGAATTGAAAGATCCATCACTGCAGCTCCATAGCTACAAATGTTATCTGTATCACTAAAGTGCAAGAAACACTTCCACTTAATGCTTGCCAACAATGCAATGTAGCACTCAACAACTGATGCATTCGGTAGGATTTTAGTCATCTAGATTTCTTTTATATCATGTAGATGAATTCTAAGTTCCTAACTGTTATTTTACTATCTGTATGAACATGATCAGTCTCATGTGCTACCTA


Protein sequences

Name Description Sequence
Pth.4966 translated coding region predicted by ESTScan from UniGene Pth.4966

MAKRRQSKILLDRGSELLEERIRFCDGRCRSNPIRNFSVDQICRAIQDFQKIHPLQSCIEFEWKKGVLDGRLVFIKRYARGGQEVYRDIVVSSQMSSHNNVLKLLGCCLEIPEGPALVYEYPENRSLDRHIHYGSLPWGTRLKIAKEIANAVAYLHTAFPRPIIHRDIKPANIFLNQNYAAKLSDFSFSISIPEGESKVGDDLLVGTFGFLDPDYTMTNFVTEKTDVFSFGVLLLVLLTGRATRQGEIHLIEHVKLLVEQDRVHEAVDPMIRGNGGEAIDQQQLEASIELALRCTDDSGEDRPLMIEVAKEIQRIERSITAAPXATNVICITKVQETLPLNACQQCNVALNN

Domains

Domain Start-End Description Sequence

ProfileScan: PS50011
IPR000719
1-315 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

MAKRRQSKILLDRGSELLEERIRFCDGRCRSNPIRNFSVDQICRAIQDFQKIHPLQSCIEFEWKKGVLDGRLVFIKRYARGGQEVYRDIVVSSQMSSHNNVLKLLGCCLEIPEGPALVYEYPENRSLDRHIHYGSLPWGTRLKIAKEIANAVAYLHTAFPRPIIHRDIKPANIFLNQNYAAKLSDFSFSISIPEGESKVGDDLLVGTFGFLDPDYTMTNFVTEKTDVFSFGVLLLVLLTGRATRQGEIHLIEHVKLLVEQDRVHEAVDPMIRGNGGEAIDQQQLEASIELALRCTDDSGEDRPLMIEVAKEIQRI

HMMPanther: PTHR24420:SF729
11-319 PROTEIN KINASE, PUTATIVE

LDRGSELLEERIRFCDGRCRSNPIRNFSVDQICRAIQDFQKIHPLQSCIEFEWKKGVLDGRLVFIKRYARGGQEVYRDIVVSSQMSSHNNVLKLLGCCLEIPEGPALVYEYPENRSLDRHIHYGSLPWGTRLKIAKEIANAVAYLHTAFPRPIIHRDIKPANIFLNQNYAAKLSDFSFSISIPEGESKVGDDLLVGTFGFLDPDYTMTNFVTEKTDVFSFGVLLLVLLTGRATRQGEIHLIEHVKLLVEQDRVHEAVDPMIRGNGGEAIDQQQLEASIELALRCTDDSGEDRPLMIEVAKEIQRIERSI

HMMPanther: PTHR24420
11-319 FAMILY NOT NAMED,FAMILY NOT NAMED

LDRGSELLEERIRFCDGRCRSNPIRNFSVDQICRAIQDFQKIHPLQSCIEFEWKKGVLDGRLVFIKRYARGGQEVYRDIVVSSQMSSHNNVLKLLGCCLEIPEGPALVYEYPENRSLDRHIHYGSLPWGTRLKIAKEIANAVAYLHTAFPRPIIHRDIKPANIFLNQNYAAKLSDFSFSISIPEGESKVGDDLLVGTFGFLDPDYTMTNFVTEKTDVFSFGVLLLVLLTGRATRQGEIHLIEHVKLLVEQDRVHEAVDPMIRGNGGEAIDQQQLEASIELALRCTDDSGEDRPLMIEVAKEIQRIERSI

superfamily: SSF56112
IPR011009
19-320 Protein kinase-like (PK-like)
Protein kinase-like domain

EERIRFCDGRCRSNPIRNFSVDQICRAIQDFQKIHPLQSCIEFEWKKGVLDGRLVFIKRYARGGQEVYRDIVVSSQMSSHNNVLKLLGCCLEIPEGPALVYEYPENRSLDRHIHYGSLPWGTRLKIAKEIANAVAYLHTAFPRPIIHRDIKPANIFLNQNYAAKLSDFSFSISIPEGESKVGDDLLVGTFGFLDPDYTMTNFVTEKTDVFSFGVLLLVLLTGRATRQGEIHLIEHVKLLVEQDRVHEAVDPMIRGNGGEAIDQQQLEASIELALRCTDDSGEDRPLMIEVAKEIQRIERSIT

HMMSmart: SM00220
IPR002290
49-315 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

FQKIHPLQSCIEFEWKKGVLDGRLVFIKRYARGGQEVYRDIVVSSQMSSHNNVLKLLGCCLEIPEGPALVYEYPENRSLDRHIHYGSLPWGTRLKIAKEIANAVAYLHTAFPRPIIHRDIKPANIFLNQNYAAKLSDFSFSISIPEGESKVGDDLLVGTFGFLDPDYTMTNFVTEKTDVFSFGVLLLVLLTGRATRQGEIHLIEHVKLLVEQDRVHEAVDPMIRGNGGEAIDQQQLEASIELALRCTDDSGEDRPLMIEVAKEIQRI

HMMSmart: SM00219
IPR020635
49-312 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

FQKIHPLQSCIEFEWKKGVLDGRLVFIKRYARGGQEVYRDIVVSSQMSSHNNVLKLLGCCLEIPEGPALVYEYPENRSLDRHIHYGSLPWGTRLKIAKEIANAVAYLHTAFPRPIIHRDIKPANIFLNQNYAAKLSDFSFSISIPEGESKVGDDLLVGTFGFLDPDYTMTNFVTEKTDVFSFGVLLLVLLTGRATRQGEIHLIEHVKLLVEQDRVHEAVDPMIRGNGGEAIDQQQLEASIELALRCTDDSGEDRPLMIEVAKEI

Gene3D: G3DSA:3.30.200.20
66-108 no description

GVLDGRLVFIKRYARGGQEVYRDIVVSSQMSSHNNVLKLLGCC

HMMPfam: PF00069
IPR017442
86-255 Pkinase,Ser-thr
Serine/threonine-protein kinase-like domain

YRDIVVSSQMSSHNNVLKLLGCCLEIPEGPALVYEYPENRSLDRHIHYGSLPWGTRLKIAKEIANAVAYLHTAFPRPIIHRDIKPANIFLNQNYAAKLSDFSFSISIPEGESKVGDDLLVGTFGFLDPDYTMTNFVTEKTDVFSFGVLLLVLLTGRATRQGEIHLIEHVK

Gene3D: G3DSA:1.10.510.10
109-304 no description

LEIPEGPALVYEYPENRSLDRHIHYGSLPWGTRLKIAKEIANAVAYLHTAFPRPIIHRDIKPANIFLNQNYAAKLSDFSFSISIPEGESKVGDDLLVGTFGFLDPDYTMTNFVTEKTDVFSFGVLLLVLLTGRATRQGEIHLIEHVKLLVEQDRVHEAVDPMIRGNGGEAIDQQQLEASIELALRCTDDSGEDRPL

PatternScan: PS00108
IPR008271
163-175 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

IIHRDIKPANIFL

Seg: seg
232-238 seg

VLLLVLL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox