PRGDB00075174 (Pth.5019)

From PRG Wiki
Jump to: navigation, search
Pth.5019
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 224110473 (XM_002315494)
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Populus trichocarpa

Comment?

Populus trichocarpa predicted protein, mRNA

DNA Sequence

ATGAAGGAAGAACTAGAATTACCCTTCTTTAACATGGATGAGTTGGCTTCTGCAACAAATAACTTTTCCGATTCCAATAAACTAGGAGAAGGGGGTTTCGGACCTGTTTATAAGGGAACATTAACAGATGGACAAGAAATAGCTGTCAAGAGGCTCTCTAAGAATTCAAGACAAGGACTTGAGGAGTTCAAAAATGAAGTCCAACATATTGTGAAACTTCAGCACCGGAATCTAGTGAGGCTTCTTGGATGCTGTATTCAAAGTGATGAGACGATGCTGGTCTACGAGTTCTTGCCTAACAAAAGCTTGGACTTCTATATTTTTGATGAGACTCATAGCTTGCTACTAGATTGGCCTAAACGCTACAACATCATTAACGGGATTGCTCGAGGACTCCTTTATCTTCACCAAGATTCCAGACTAAGAATAATCCACAGAGATCTGAAAACCAGCAATATTTTGTTGGATTACGAAATGAATCCAAAAATCTCAGACTTTGGCCTGGCTAGAAGTTTTGGAGAAAATGAAACGGAAGCCAATACTAATAAAGTGGCTGGAACGTATGGTTACATATCTCCAGAGTACGCAAATTATGGACTCTACTCACTAAAATCAGACGTCTTCAGCTTTGGAGTATTGGTGCTAGAGATAGTGACTGGCTATAGGAACAGGGGATTCAGTCACCCAGATCACCACCTCAACCTTATCGGGCATGCTTGGATACTGTTCAAGCAAGGCAGGTCTCTGGAACTGGCTGCGGGATCAGGAGTTGAAACACCCTATTTGTCTGAAGTCCTACGTTCAATTCATGTGGGGCTGTTGTGTGTGCAAGAAAATACAGAAGATCGACCAAACATATCACATGTGGTTTTGATGTTGGGTAATGAAGATGAATTGCCTCAGCCTAAACAACCAGGATTTTTCACTGAAAGGGATCTTGATGAAGCAAGCTATTCATCGAGCCAGAACAAACCACCTTCGGCAAACGGATGCTCGATTTCAATGTTAGAGGCAAGATAGATTGCTTTTATTTCATTTCAAGTGATTAAAGGCGAATTAATATTCGATAGATGTTCTAGTTGCAGAACAGGAATTACGAACAAAAGCAAGTCAAATAAATGCTTCTAAAGCTTAGTGTCTCTATGAAACGTGAAGAAATTGATGACAAGTATCTTCATGTAATCCAAGAGTTGCAGCTACATTTATGAATCATGGGGAGGGGACTCCAGATATTTCTCTTACTTGATGTTCATGTATCATCAAGACTTGCCAGCTAGTATTTCATCTTATAGATTTGAACATTTCATTAGAACATTTGTATTTAAGTTTGTTTTTGAAACATAAATTACCATCAAGTTTGTGATAATATTTTAAGATTAATAAGTTCTCTTTTATAA


Protein sequences

Name Description Sequence
Pth.5019 translated coding region predicted by ESTScan from UniGene Pth.5019

MKEELELPFFNMDELASATNNFSDSNKLGEGGFGPVYKGTLTDGQEIAVKRLSKNSRQGLEEFKNEVQHIVKLQHRNLVRLLGCCIQSDETMLVYEFLPNKSLDFYIFDETHSLLLDWPKRYNIINGIARGLLYLHQDSRLRIIHRDLKTSNILLDYEMNPKISDFGLARSFGENETEANTNKVAGTYGYISPEYANYGLYSLKSDVFSFGVLVLEIVTGYRNRGFSHPDHHLNLIGHAWILFKQGRSLELAAGSGVETPYLSEVLRSIHVGLLCVQENTEDRPNISHVVLMLGNEDELPQPKQPGFFTERDLDEASYSSSQNKPPSANGCSISMLEAR

Domains

Domain Start-End Description Sequence

Gene3D: G3DSA:3.30.200.20
6-84 G3DSA:3.30.200.20

ELPFFNMDELASATNNFSDSNKLGEGGFGPVYKGTLTDGQEIAVKRLSKNSRQGLEEFKNEVQHIVKLQHRNLVRLLGC

HMMPanther: PTHR24420
6-334 PTHR24420,FAMILY NOT NAMED

ELPFFNMDELASATNNFSDSNKLGEGGFGPVYKGTLTDGQEIAVKRLSKNSRQGLEEFKNEVQHIVKLQHRNLVRLLGCCIQSDETMLVYEFLPNKSLDFYIFDETHSLLLDWPKRYNIINGIARGLLYLHQDSRLRIIHRDLKTSNILLDYEMNPKISDFGLARSFGENETEANTNKVAGTYGYISPEYANYGLYSLKSDVFSFGVLVLEIVTGYRNRGFSHPDHHLNLIGHAWILFKQGRSLELAAGSGVETPYLSEVLRSIHVGLLCVQENTEDRPNISHVVLMLGNEDELPQPKQPGFFTERDLDEASYSSSQNKPPSANGCSIS

HMMPanther: PTHR24420:SF430
6-334 PTHR24420:SF430,SUBFAMILY NOT NAMED

ELPFFNMDELASATNNFSDSNKLGEGGFGPVYKGTLTDGQEIAVKRLSKNSRQGLEEFKNEVQHIVKLQHRNLVRLLGCCIQSDETMLVYEFLPNKSLDFYIFDETHSLLLDWPKRYNIINGIARGLLYLHQDSRLRIIHRDLKTSNILLDYEMNPKISDFGLARSFGENETEANTNKVAGTYGYISPEYANYGLYSLKSDVFSFGVLVLEIVTGYRNRGFSHPDHHLNLIGHAWILFKQGRSLELAAGSGVETPYLSEVLRSIHVGLLCVQENTEDRPNISHVVLMLGNEDELPQPKQPGFFTERDLDEASYSSSQNKPPSANGCSIS

superfamily: SSF56112
IPR011009
8-293 Kinase_like
Protein kinase-like domain

PFFNMDELASATNNFSDSNKLGEGGFGPVYKGTLTDGQEIAVKRLSKNSRQGLEEFKNEVQHIVKLQHRNLVRLLGCCIQSDETMLVYEFLPNKSLDFYIFDETHSLLLDWPKRYNIINGIARGLLYLHQDSRLRIIHRDLKTSNILLDYEMNPKISDFGLARSFGENETEANTNKVAGTYGYISPEYANYGLYSLKSDVFSFGVLVLEIVTGYRNRGFSHPDHHLNLIGHAWILFKQGRSLELAAGSGVETPYLSEVLRSIHVGLLCVQENTEDRPNISHVVLML

ProfileScan: PS50011
IPR000719
22-307 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

FSDSNKLGEGGFGPVYKGTLTDGQEIAVKRLSKNSRQGLEEFKNEVQHIVKLQHRNLVRLLGCCIQSDETMLVYEFLPNKSLDFYIFDETHSLLLDWPKRYNIINGIARGLLYLHQDSRLRIIHRDLKTSNILLDYEMNPKISDFGLARSFGENETEANTNKVAGTYGYISPEYANYGLYSLKSDVFSFGVLVLEIVTGYRNRGFSHPDHHLNLIGHAWILFKQGRSLELAAGSGVETPYLSEVLRSIHVGLLCVQENTEDRPNISHVVLMLGNEDELPQPKQPGF

HMMPfam: PF07714
IPR001245
25-290 Pkinase_Tyr
Serine-threonine/tyrosine-protein kinase

SNKLGEGGFGPVYKGTLTDGQEIAVKRLSKNSRQGLEEFKNEVQHIVKLQHRNLVRLLGCCIQSDETMLVYEFLPNKSLDFYIFDETHSLLLDWPKRYNIINGIARGLLYLHQDSRLRIIHRDLKTSNILLDYEMNPKISDFGLARSFGENETEANTNKVAGTYGYISPEYANYGLYSLKSDVFSFGVLVLEIVTGYRNRGFSHPDHHLNLIGHAWILFKQGRSLELAAGSGVETPYLSEVLRSIHVGLLCVQENTEDRPNISHVV

Gene3D: G3DSA:1.10.510.10
85-290 G3DSA:1.10.510.10

CIQSDETMLVYEFLPNKSLDFYIFDETHSLLLDWPKRYNIINGIARGLLYLHQDSRLRIIHRDLKTSNILLDYEMNPKISDFGLARSFGENETEANTNKVAGTYGYISPEYANYGLYSLKSDVFSFGVLVLEIVTGYRNRGFSHPDHHLNLIGHAWILFKQGRSLELAAGSGVETPYLSEVLRSIHVGLLCVQENTEDRPNISHVV

PatternScan: PS00108
IPR008271
143-155 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

IIHRDLKTSNILL

HMMPfam: PF11883
IPR021820
297-339 DUF3403
S-locus receptor kinase, C-terminal

DELPQPKQPGFFTERDLDEASYSSSQNKPPSANGCSISMLEAR






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox