PRGDB00075176 (Pth.5047)

From PRG Wiki
Jump to: navigation, search
Pth.5047
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 224087372 (XM_002308105)
Gene Class Unknown
Domain Type LRR
Gene Species Populus trichocarpa

Comment?

Populus trichocarpa predicted protein, mRNA

DNA Sequence

ACACTGTCCAGCGTATCTCATATGACTCCAACTCTCTCCTTCATGTGACTTGCTTCTCTTCATACAGGCAAGCATCAATGTCATCTCCTCCTCGCTTATTCTTGATTCTTTTCTTGCTTGTTTCCACTTCCTCTTTCCTCTTCCAGATCTCCTCTGCAGCCCATGAAGATGAAGATCATGATATAGACGTAGATCCAAACCTCAAGTTTGAGAACCCTAGGATCCGCAGAGCCTACATTGCCTTGCAGTCATGGAAACAAGCCATCTATTCAGACCCACTCAACTTCACGGCCAACTGGAAGGGCTCAGACGTGTGCTCTTACATGGGGATCTTTTGTGCTCCATCTCCCCAGAACAAGAAAGTAAGGGTGGTGGCTGGCATTGACCTCAACCATGCTGACATTGCTGGCTACCTCCCTACCGAGCTCGGCCTTCTTACCGATCTGGCACTCTTCCACATCAACTCCAACAGATTCTGTGGAGTGGTGCCCAATAGTTTCAGCAAAATGAAGCTTCTACATGAGCTGGACCTTAGCAATAATCGGTTTGTGGGCAAATTTCCGAAGGTTGTGCTCTCACTGCCTTCCCTCAAGTACTTGGATCTGCGCTTCAACGAGTTTGAAGGTTCTGTGCCCTCCCAGCTCTTTGACAAGCCTCTTGATGCTATCTTCTTGAACGACAACAGGTTCCAGTTTGGCATCCCAGAGAATCTTGGGAACTCTCCTGTTTCTGTTCTTGTCTTTGCGAACAACAACCTTGGTGGGTGCATTCCAGGCAGCATCGGAAAGATGGGCAAAACCCTGAACGAGATCATTCTCATGAACGACAATCTCACTGGATGCTTGCCTCCCCAGATCGGGATGCTCAAGGAAGTAACTGTTTTTGACGTGAGCTTCAATCATCTTCAAGGCTCTCTCCCTTCCAGCATTGGAAACATGAAGAGTGTTGAGCAACTTGACATTGCACACAACAGTTTCACAGGTGCTATACCTGCCAGTGTTTGCCAGTTGCCTAATTTGCAAAACTTCACCTTTTCTTTCAACTATTTCACTGGCGAAGCTCCTAGCTGTGCTGCTATCGGAGGCGTCTCCAATGGTACCCAGAATTGCATTCCTGGAAAGACAAATCAGAGATCAGCCAAGCAATGTTCTTCTGAAGCTGCACGCCCTGTTGACTGCAGCAAGTTCAAATGCGTATCGCCCAGAACACATCTTCCACCACCACCGCCTCCACCCCCATCTCCACCTCCACCTGTAGAACAACAGCCACCAACTTATCACCATATACCGCCACCACCATCTCCTCCTCCTCCACCCAGCCATTACCATTCAAATCATCCAGCACCGCCACCTATCGAAAAAGTCTCACCCGGTACTCATTACCATGTACCACCACCCCCGCCTTCCCATCAATACCAAGCACCACCGCCACCAAAGCAGTCAGCTGAAGTTCCAGCACCAAGTTACCACCCTAACTCTCCACCACCACCCCCGCCTTCCTGTCAGTACCAAGCACCACCGCCACCAAAGCAGTCAGCCGGGGTTCCAGCACCAAGTTACCACACTAACTCTCCGCCACCACCCCCTCCACCAACTAATGGATATACACATTCTCCTCCTCCAACCCAGCCTACAGCTCCAGTTCCATCACCA


Protein sequences

Name Description Sequence
Pth.5047 translated coding region predicted by ESTScan from UniGene Pth.5047

XTVQRISYDSNSLLHVTCFSSYRQASMSSPPRLFLILFLLVSTSSFLFQISSAAHEDEDHDIDVDPNLKFENPRIRRAYIALQSWKQAIYSDPLNFTANWKGSDVCSYMGIFCAPSPQNKKVRVVAGIDLNHADIAGYLPTELGLLTDLALFHINSNRFCGVVPNSFSKMKLLHELDLSNNRFVGKFPKVVLSLPSLKYLDLRFNEFEGSVPSQLFDKPLDAIFLNDNRFQFGIPENLGNSPVSVLVFANNNLGGCIPGSIGKMGKTLNEIILMNDNLTGCLPPQIGMLKEVTVFDVSFNHLQGSLPSSIGNMKSVEQLDIAHNSFTGAIPASVCQLPNLQNFTFSFNYFTGEAPSCAAIGGVSNGTQNCIPGKTNQRSAKQCSSEAARPVDCSKFKCVSPRTHLPPPPPPPPSPPPPVEQQPPTYHHIPPPPSPPPPPSHYHSNHPAPPPIEKVSPGTHYHVPPPPPSHQYQAPPPPKQSAEVPAPSYHPNSPPPPPPSCQYQAPPPPKQSAGVPAPSYHTNSPPPPPPPTNGYTHSPPPTQPTAPVPSP

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR24420:SF665
11-498 SUBFAMILY NOT NAMED

NSLLHVTCFSSYRQASMSSPPRLFLILFLLVSTSSFLFQISSAAHEDEDHDIDVDPNLKFENPRIRRAYIALQSWKQAIYSDPLNFTANWKGSDVCSYMGIFCAPSPQNKKVRVVAGIDLNHADIAGYLPTELGLLTDLALFHINSNRFCGVVPNSFSKMKLLHELDLSNNRFVGKFPKVVLSLPSLKYLDLRFNEFEGSVPSQLFDKPLDAIFLNDNRFQFGIPENLGNSPVSVLVFANNNLGGCIPGSIGKMGKTLNEIILMNDNLTGCLPPQIGMLKEVTVFDVSFNHLQGSLPSSIGNMKSVEQLDIAHNSFTGAIPASVCQLPNLQNFTFSFNYFTGEAPSCAAIGGVSNGTQNCIPGKTNQRSAKQCSSEAARPVDCSKFKCVSPRTHLPPPPPPPPSPPPPVEQQPPTYHHIPPPPSPPPPPSHYHSNHPAPPPIEKVSPGTHYHVPPPPPSHQYQAPPPPKQSAEVPAPSYHPNSPPPPP

HMMPanther: PTHR24420
11-498 FAMILY NOT NAMED,FAMILY NOT NAMED

NSLLHVTCFSSYRQASMSSPPRLFLILFLLVSTSSFLFQISSAAHEDEDHDIDVDPNLKFENPRIRRAYIALQSWKQAIYSDPLNFTANWKGSDVCSYMGIFCAPSPQNKKVRVVAGIDLNHADIAGYLPTELGLLTDLALFHINSNRFCGVVPNSFSKMKLLHELDLSNNRFVGKFPKVVLSLPSLKYLDLRFNEFEGSVPSQLFDKPLDAIFLNDNRFQFGIPENLGNSPVSVLVFANNNLGGCIPGSIGKMGKTLNEIILMNDNLTGCLPPQIGMLKEVTVFDVSFNHLQGSLPSSIGNMKSVEQLDIAHNSFTGAIPASVCQLPNLQNFTFSFNYFTGEAPSCAAIGGVSNGTQNCIPGKTNQRSAKQCSSEAARPVDCSKFKCVSPRTHLPPPPPPPPSPPPPVEQQPPTYHHIPPPPSPPPPPSHYHSNHPAPPPIEKVSPGTHYHVPPPPPSHQYQAPPPPKQSAEVPAPSYHPNSPPPPP

Seg: seg
28-48 seg

SSPPRLFLILFLLVSTSSFLF

superfamily: SSF52058
72-356 L domain-like,LRR

NPRIRRAYIALQSWKQAIYSDPLNFTANWKGSDVCSYMGIFCAPSPQNKKVRVVAGIDLNHADIAGYLPTELGLLTDLALFHINSNRFCGVVPNSFSKMKLLHELDLSNNRFVGKFPKVVLSLPSLKYLDLRFNEFEGSVPSQLFDKPLDAIFLNDNRFQFGIPENLGNSPVSVLVFANNNLGGCIPGSIGKMGKTLNEIILMNDNLTGCLPPQIGMLKEVTVFDVSFNHLQGSLPSSIGNMKSVEQLDIAHNSFTGAIPASVCQLPNLQNFTFSFNYFTGEAPS

Gene3D: G3DSA:3.80.10.10
75-358 no description

IRRAYIALQSWKQAIYSDPLNFTANWKGSDVCSYMGIFCAPSPQNKKVRVVAGIDLNHADIAGYLPTELGLLTDLALFHINSNRFCGVVPNSFSKMKLLHELDLSNNRFVGKFPKVVLSLPSLKYLDLRFNEFEGSVPSQLFDKPLDAIFLNDNRFQFGIPENLGNSPVSVLVFANNNLGGCIPGSIGKMGKTLNEIILMNDNLTGCLPPQIGMLKEVTVFDVSFNHLQGSLPSSIGNMKSVEQLDIAHNSFTGAIPASVCQLPNLQNFTFSFNYFTGEAPSCA

HMMPfam: PF08263
IPR013210
81-113 LRRNT_2
Leucine-rich repeat-containing N-terminal, type 2

ALQSWKQAIYSDPLNFTANWKGSDVCSYMGIFC

HMMPfam: PF13855
152-206 LRR_8,Leucine rich repeat

FHINSNRFCGVVPNSFSKMKLLHELDLSNNRFVGKFPKVVLSLPSLKYLDLRFNE

FPrintScan: PR01217
399-411 PRICHEXTENSN,Proline rich extensin signature

VSPRTHLPPPPPP

Seg: seg
406-451 seg

PPPPPPPPSPPPPVEQQPPTYHHIPPPPSPPPPPSHYHSNHPAPPP

FPrintScan: PR01217
412-433 PRICHEXTENSN,Proline rich extensin signature

PPSPPPPVEQQPPTYHHIPPPP

FPrintScan: PR01217
433-449 PRICHEXTENSN,Proline rich extensin signature

PSPPPPPSHYHSNHPAP

FPrintScan: PR01217
454-471 PRICHEXTENSN,Proline rich extensin signature

KVSPGTHYHVPPPPPSHQ

Seg: seg
464-478 seg

PPPPPSHQYQAPPPP

Seg: seg
485-509 seg

PAPSYHPNSPPPPPPSCQYQAPPPP

Seg: seg
516-551 seg

PAPSYHTNSPPPPPPPTNGYTHSPPPTQPTAPVPSP






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox