PRGDB00075178 (Pth.5092)

From PRG Wiki
Jump to: navigation, search
Pth.5092
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 224126988 (XM_002319943)
Gene Class RLP
Domain Type LRR, Ser-Thr Kinase
Gene Species Populus trichocarpa

Comment?

Populus trichocarpa predicted protein, mRNA

DNA Sequence

ATGAAGTTCTTCCGGGCTTCAGTTATTCATTTATTCATCATCCTAACCATCATTTTTCCCTTTGCTATTTCTGACCTGAAGTCAGATAAGCAAGCTCTTCTTGACTTTGCTGCTGTTGTACCCCATTCAAGGAAGCTCAACTGGAACCCTGCTTCATTGGTCTGCAAGTCTTGGGTAGGTGTCACTTGCAATTCGAATGACACTCGTGTGGTTGAACTTCGACTCCCTGGAGTAGGACTTTTGGGTCATGTCCCACCAAACACCCTTGGTAAACTAGATGCCCTCAATACTCTCAGCCTCCGATCCAATGTCCTTGAAGGTGACCTTCCTTCTGATGTTACCTCTCTTCCATCACTCCAGAACCTCTTTCTCCAACATAATAACTTTTCTGGTGGTGTTCCAACCTCCTTTTCCTTGAAGCTCAATGTACTGGATCTCTCATTCAATTCTTTCACAGGCAACATTCCCCAAACAATAGCAAATTTAACACAACTTACCGGATTAAGCCTCCAAAATAACGCACTTTCTGGACCCATACCTGATCTCAACCACACTAGGATCAAGCATTTGAATTTAAGCTACAACCATCTTAATGGATCAATTCCAGTGTCTCTTCAAAAGTTCCCTAATTCATCCTTCATTGGAAACTCTCTCTTATGTGGACCACCTCTTAATCCTTGCTCCATAGTCCTTCCTCCTCCTCCATCCCCTGCTTACACCCCCCCACCAGCAACTTCACATAAGCGAAGCTCAAAATTGAAACTGACAATGGGAGCAATCATTGCCATTGCCGTGGGAGGGTCTGCTGTGCTGTTTCTTGTCGTTTTAATCGTCTTTTGCTGCTGTTTGAAGAAAAAAGATAATGAAGGCCCTGGTGTGTTGAAAGGGAAAGCAGTTAGCAGTGGTAGGGGTGAGAAGCCCAAAGAGGATTTTGGAAGTGGGGTGCAAGAATCTGAGAAAAACAAGCTGGTATTCTTTGAAGGCTGCTCTTACAATTTCGATCTCGAGGATTTATTAAGAGCTTCAGCTGAAGTTTTAGGAAAGGGTAGTTATGGTACAGCATATAAGGCTGTCTTGGAGGAATCAACCACAGTGGTGGTGAAAAGGTTGAAAGAAGTGGTGGTGGGAAAGAGAGACTTTGAGCAGCAGATGGAGATTGCGGGGAGAGTTGGGCAGCACCCAAATGTTGTGCCACTTCGTGCTTATTATTACTCAAAGGATGAGAGGCTTCTAGTGTATGACTATATCCCAGGTGGCAGCTTATCCACGCTTTTGCATGCAAACAGGGGAGCTGGCAGAACTCCACTAGATTGGGACTCTAGGGTTAAGATTGCCCTTGGTACTGCACGGGGAATTTCCCACCTTCATTCTGCTGGCGGTCCAAAGTTTACTCATGGAAATATCAAGTCGTCAAATGTCCTCCTCAGCCAAGATCATGATGGTTGCATCTCTGATTTTGGCCTGACACCTCTTATGAACGTCCCTGCTTCTTCATCTCGGAGTGCTGGTTATCGTGCTCCTGAGGTGATTGAAACCAGTAAGCACTCTCATAAATCAGATGTCTACAGCTTTGGTGTCATCCTTCTCGAGATGCTGACTGGGAAAGCTCCAATCCAATCACCAAGGCGTGATGACATGGTTGATCTCCCAAGATGGGTCCAATCAGTTGTAAGGGAGGAGTGGACAGCTGAGGTTTTCGATGTTGAACTGATGAGATACCAAAACATTGAAGAAGAAATGGTGCAGATGTTGCAAATTGGGATGACCTGTGTAGCAAAGGTGCCAGACATGCGACCTAACATGGAAGAAGTTGTTCGAATGATTGAAGAAATCCGGCAATCTGACTCAGAGAACCGGCCATCTTCTGAAGGGAACAAGTCCAAGGACTCAAATGTGCATACTCCATGATTGACGAAATTGTTGCTGCTTGATTTTAAGATCAAGATTCAAAAAGTGCTATGAGCACCTGCCTTGTAAGGTTTCTCGAGCATTTATTCAAGCTTATGTGTATGTGCAGTGCAGCATCATAGAGTGTGAATTTGTCTCAAttttttttcttcttttttCAGATATGTAGCAGTGCTTTGATTTTTAATTTTTAAGTCTGATTAGCTGGAAACCTCTTGATTTGTTGTAAAACTTCATTCAAAATTTGTGAATGAATTGATGAGACTTGAATCAAGAACACTCCATTTTTTTCTGC


Protein sequences

Name Description Sequence
Pth.5092 translated coding region predicted by ESTScan from UniGene Pth.5092

MKFFRASVIHLFIILTIIFPFAISDLKSDKQALLDFAAVVPHSRKLNWNPASLVCKSWVGVTCNSNDTRVVELRLPGVGLLGHVPPNTLGKLDALNTLSLRSNVLEGDLPSDVTSLPSLQNLFLQHNNFSGGVPTSFSLKLNVLDLSFNSFTGNIPQTIANLTQLTGLSLQNNALSGPIPDLNHTRIKHLNLSYNHLNGSIPVSLQKFPNSSFIGNSLLCGPPLNPCSIVLPPPPSPAYTPPPATSHKRSSKLKLTMGAIIAIAVGGSAVLFLVVLIVFCCCLKKKDNEGPGVLKGKAVSSGRGEKPKEDFGSGVQESEKNKLVFFEGCSYNFDLEDLLRASAEVLGKGSYGTAYKAVLEESTTVVVKRLKEVVVGKRDFEQQMEIAGRVGQHPNVVPLRAYYYSKDERLLVYDYIPGGSLSTLLHANRGAGRTPLDWDSRVKIALGTARGISHLHSAGGPKFTHGNIKSSNVLLSQDHDGCISDFGLTPLMNVPASSSRSAGYRAPEVIETSKHSHKSDVYSFGVILLEMLTGKAPIQSPRRDDMVDLPRWVQSVVREEWTAEVFDVELMRYQNIEEEMVQMLQIGMTCVAKVPDMRPNMEEVVRMIEEIRQSDSENRPSSEGNKSKDSNVHTP

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR24420:SF779
8-635 PTHR24420:SF779

VIHLFIILTIIFPFAISDLKSDKQALLDFAAVVPHSRKLNWNPASLVCKSWVGVTCNSNDTRVVELRLPGVGLLGHVPPNTLGKLDALNTLSLRSNVLEGDLPSDVTSLPSLQNLFLQHNNFSGGVPTSFSLKLNVLDLSFNSFTGNIPQTIANLTQLTGLSLQNNALSGPIPDLNHTRIKHLNLSYNHLNGSIPVSLQKFPNSSFIGNSLLCGPPLNPCSIVLPPPPSPAYTPPPATSHKRSSKLKLTMGAIIAIAVGGSAVLFLVVLIVFCCCLKKKDNEGPGVLKGKAVSSGRGEKPKEDFGSGVQESEKNKLVFFEGCSYNFDLEDLLRASAEVLGKGSYGTAYKAVLEESTTVVVKRLKEVVVGKRDFEQQMEIAGRVGQHPNVVPLRAYYYSKDERLLVYDYIPGGSLSTLLHANRGAGRTPLDWDSRVKIALGTARGISHLHSAGGPKFTHGNIKSSNVLLSQDHDGCISDFGLTPLMNVPASSSRSAGYRAPEVIETSKHSHKSDVYSFGVILLEMLTGKAPIQSPRRDDMVDLPRWVQSVVREEWTAEVFDVELMRYQNIEEEMVQMLQIGMTCVAKVPDMRPNMEEVVRMIEEIRQSDSENRPSSEGNKSKDSNVHTP

HMMPanther: PTHR24420
8-635 PTHR24420,FAMILY NOT NAMED

VIHLFIILTIIFPFAISDLKSDKQALLDFAAVVPHSRKLNWNPASLVCKSWVGVTCNSNDTRVVELRLPGVGLLGHVPPNTLGKLDALNTLSLRSNVLEGDLPSDVTSLPSLQNLFLQHNNFSGGVPTSFSLKLNVLDLSFNSFTGNIPQTIANLTQLTGLSLQNNALSGPIPDLNHTRIKHLNLSYNHLNGSIPVSLQKFPNSSFIGNSLLCGPPLNPCSIVLPPPPSPAYTPPPATSHKRSSKLKLTMGAIIAIAVGGSAVLFLVVLIVFCCCLKKKDNEGPGVLKGKAVSSGRGEKPKEDFGSGVQESEKNKLVFFEGCSYNFDLEDLLRASAEVLGKGSYGTAYKAVLEESTTVVVKRLKEVVVGKRDFEQQMEIAGRVGQHPNVVPLRAYYYSKDERLLVYDYIPGGSLSTLLHANRGAGRTPLDWDSRVKIALGTARGISHLHSAGGPKFTHGNIKSSNVLLSQDHDGCISDFGLTPLMNVPASSSRSAGYRAPEVIETSKHSHKSDVYSFGVILLEMLTGKAPIQSPRRDDMVDLPRWVQSVVREEWTAEVFDVELMRYQNIEEEMVQMLQIGMTCVAKVPDMRPNMEEVVRMIEEIRQSDSENRPSSEGNKSKDSNVHTP

superfamily: SSF52058
20-228 SSF52058,LRR

PFAISDLKSDKQALLDFAAVVPHSRKLNWNPASLVCKSWVGVTCNSNDTRVVELRLPGVGLLGHVPPNTLGKLDALNTLSLRSNVLEGDLPSDVTSLPSLQNLFLQHNNFSGGVPTSFSLKLNVLDLSFNSFTGNIPQTIANLTQLTGLSLQNNALSGPIPDLNHTRIKHLNLSYNHLNGSIPVSLQKFPNSSFIGNSLLCGPPLNPCS

HMMPfam: PF08263
IPR013210
27-64 LRRNT_2
Leucine-rich repeat-containing N-terminal, type 2

KSDKQALLDFAAVVPHSRKLNWNPASLVCKSWVGVTCN

Gene3D: G3DSA:3.80.10.10
40-213 G3DSA:3.80.10.10

VPHSRKLNWNPASLVCKSWVGVTCNSNDTRVVELRLPGVGLLGHVPPNTLGKLDALNTLSLRSNVLEGDLPSDVTSLPSLQNLFLQHNNFSGGVPTSFSLKLNVLDLSFNSFTGNIPQTIANLTQLTGLSLQNNALSGPIPDLNHTRIKHLNLSYNHLNGSIPVSLQKFPNSSF

HMMPfam: PF13855
72-129 LRR_8,Leucine rich repeat

ELRLPGVGLLGHVPPNTLGKLDALNTLSLRSNVLEGDLPSDVTSLPSLQNLFLQHNNF

HMMPfam: PF00560
IPR001611
140-162 LRR_1
Leucine-rich repeat

KLNVLDLSFNSFTGNIPQTIANL

HMMPfam: PF00560
IPR001611
187-207 LRR_1
Leucine-rich repeat

IKHLNLSYNHLNGSIPVSLQK

Gene3D: G3DSA:3.30.200.20
271-415 G3DSA:3.30.200.20

LFLVVLIVFCCCLKKKDNEGPGVLKGKAVSSGRGEKPKEDFGSGVQESEKNKLVFFEGCSYNFDLEDLLRASAEVLGKGSYGTAYKAVLEESTTVVVKRLKEVVVGKRDFEQQMEIAGRVGQHPNVVPLRAYYYSKDERLLVYDY

superfamily: SSF56112
IPR011009
308-616 Kinase_like
Protein kinase-like domain

KEDFGSGVQESEKNKLVFFEGCSYNFDLEDLLRASAEVLGKGSYGTAYKAVLEESTTVVVKRLKEVVVGKRDFEQQMEIAGRVGQHPNVVPLRAYYYSKDERLLVYDYIPGGSLSTLLHANRGAGRTPLDWDSRVKIALGTARGISHLHSAGGPKFTHGNIKSSNVLLSQDHDGCISDFGLTPLMNVPASSSRSAGYRAPEVIETSKHSHKSDVYSFGVILLEMLTGKAPIQSPRRDDMVDLPRWVQSVVREEWTAEVFDVELMRYQNIEEEMVQMLQIGMTCVAKVPDMRPNMEEVVRMIEEIRQSDS

ProfileScan: PS50011
IPR000719
340-635 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

RASAEVLGKGSYGTAYKAVLEESTTVVVKRLKEVVVGKRDFEQQMEIAGRVGQHPNVVPLRAYYYSKDERLLVYDYIPGGSLSTLLHANRGAGRTPLDWDSRVKIALGTARGISHLHSAGGPKFTHGNIKSSNVLLSQDHDGCISDFGLTPLMNVPASSSRSAGYRAPEVIETSKHSHKSDVYSFGVILLEMLTGKAPIQSPRRDDMVDLPRWVQSVVREEWTAEVFDVELMRYQNIEEEMVQMLQIGMTCVAKVPDMRPNMEEVVRMIEEIRQSDSENRPSSEGNKSKDSNVHTP

HMMPfam: PF00069
IPR017442
344-620 Pkinase,Ser-thr
Serine/threonine-protein kinase-like domain

EVLGKGSYGTAYKAVLEESTTVVVKRLKEVVVGKRDFEQQMEIAGRVGQHPNVVPLRAYYYSKDERLLVYDYIPGGSLSTLLHANRGAGRTPLDWDSRVKIALGTARGISHLHSAGGPKFTHGNIKSSNVLLSQDHDGCISDFGLTPLMNVPASSSRSAGYRAPEVIETSKHSHKSDVYSFGVILLEMLTGKAPIQSPRRDDMVDLPRWVQSVVREEWTAEVFDVELMRYQNIEEEMVQMLQIGMTCVAKVPDMRPNMEEVVRMIEEIRQSDSENRP

PatternScan: PS00107
IPR017441
346-377 PROTEIN_KINASE_ATP
Protein kinase, ATP binding site

LGKGSYGTAYKAVLEESTTVVVKRLKEVVVGK

Gene3D: G3DSA:1.10.510.10
416-629 G3DSA:1.10.510.10

IPGGSLSTLLHANRGAGRTPLDWDSRVKIALGTARGISHLHSAGGPKFTHGNIKSSNVLLSQDHDGCISDFGLTPLMNVPASSSRSAGYRAPEVIETSKHSHKSDVYSFGVILLEMLTGKAPIQSPRRDDMVDLPRWVQSVVREEWTAEVFDVELMRYQNIEEEMVQMLQIGMTCVAKVPDMRPNMEEVVRMIEEIRQSDSENRPSSEGNKSKD






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox