PRGDB00075180 (Pth.5121)

From PRG Wiki
Jump to: navigation, search
Pth.5121
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 118482404 (EF144923)
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Populus trichocarpa

Comment?

Populus trichocarpa clone WS01119_O12 unknown mRNA

DNA Sequence

GATTTGTAATTTTGTATCCAACATCACAAATTATTTATGTGCAAAACCAAAATGGCTGTCAGCGCGTCCGAACCAACTCCCGTCTCAACCCAAACTCGCCCAACTCAATCACCTAGAACTCGCCCAACTCAGTCTCCTAGACCCACCACCATCACCACCGCTTCTACCTCCTCAGATCCTTCGACGTCTAACACCATTAATTACACAACAACAACATCTTCTACTCTTTCAAACCGAACCTCTCTTTCCAACCTCCGTGATTCCCTCTCTCAAAACCCCAACGTCTACGACATTTCCGAAATTCGTACAGCCACCAACAACTTCCTGTCCAAACGCCActcctcctcctcctcctccACCGCTTGCTGGCGTTGCGACTTGCGGAACAACAACACCATCATCTTCCAACGCAAGTTCCGCCGCAAAATTGAAATGTCTCAACTGAAAGAACAGCTTTCAGTAATTTGTAGAAGTAATCACTCAAGCGTGGTAAAGCTCTTAGGAGCTTCCATATCTGGAGATTATATCTACCTCGTTTATGAATTCATTCCCGGCGCAAATCTTTCTAATTGCTTGAGAAATTCTAAAAACCCCAACTTCACAGTTCTTTCGACATGGGTTTCAAGAATGCAGGTGGCCGCTGATCTTGCGTACGGTCTTGATTACATCCACAACAAAACTGGCTTAAACATAAGCTTGGTACACAACCACATTAAAAGCAGCAGTATCATTATCACAGAGCCGTCTTTTAATGCTAAAATCTGCCATTTTGGGTGTGCCCAGTTGTGTGGAGAAGCCGAtgagaatgagatgatgatgaagaaaaaaagcaagatcggtgaaatcactgaactggatgatgatCGTTCGCTAAAAGGGTCGAAAGAGTTGGCGAGGTCTAACAGCGGGATCATGCAATTCGAAGGCGTGAGAGGATACATGTCGCCGGAATATCAAGCTACGGGAATAGCAACACAGAAATCGGACGTTTACGCATTTGGGGTGGTGTTATTGGAGTTGTTGTCCGGTAAAGAGCCATATAAGTACAAGTATGACAAAAGCAGAGGTGATTATATGAGGGAGTCGGTGATTGAGACCGCCAGAGCGGCGATTGGTGACCggggggggTTGAGGAGGTGGATTGACGGGAGGCTTAAGGACTCGTTCCCAGTGGAAGTAGCAGAGAAGATGACACGTGTAGGGTTAGATTGTGTGGAAGTGGATCCAGATAAGCGGCCAGATATGGGACGCGTGGCGGGGAAGATTTCGAGGTGGTATCTGGAGTCGAGGAAGTGGGCTGAAGATTTGAGATTTTCTGACCAGATTACTGTTTCTTTGGCTCCTCGATAGATAACCAGCTATGGATAGAGATGAGTTGAAGAAAAAAACAGTCtttttattttttatttttttAATTTGCTCGTAGGGCGTGGATTGTTTTTTGTTACCTTTGATGGTGACACAAGTGGTTGATGATGGATATTTATATTTGTTTTGAATTTTACTaaaaaaaaaaaaaaaaaaaa


Protein sequences

Name Description Sequence
Pth.5121 translated coding region predicted by ESTScan from UniGene Pth.5121

MAVSASEPTPVSTQTRPTQSPRTRPTQSPRPTTITTASTSSDPSTSNTINYTTTTSSTLSNRTSLSNLRDSLSQNPNVYDISEIRTATNNFLSKRHSSSSSSTACWRCDLRNNNTIIFQRKFRRKIEMSQLKEQLSVICRSNHSSVVKLLGASISGDYIYLVYEFIPGANLSNCLRNSKNPNFTVLSTWVSRMQVAADLAYGLDYIHNKTGLNISLVHNHIKSSSIIITEPSFNAKICHFGCAQLCGEADENEMMMKKKSKIGEITELDDDRSLKGSKELARSNSGIMQFEGVRGYMSPEYQATGIATQKSDVYAFGVVLLELLSGKEPYKYKYDKSRGDYMRESVIETARAAIGDRGGLRRWIDGRLKDSFPVEVAEKMTRVGLDCVEVDPDKRPDMGRVAGKISRWYLESRKWAEDLRFSDQITVSLAPR

Domains

Domain Start-End Description Sequence

Seg: seg
12-73 seg

STQTRPTQSPRTRPTQSPRPTTITTASTSSDPSTSNTINYTTTTSSTLSNRTSLSNLRDSLS

HMMPanther: PTHR24420:SF931
22-414 PROTEIN KINASE FAMILY PROTEIN

RTRPTQSPRPTTITTASTSSDPSTSNTINYTTTTSSTLSNRTSLSNLRDSLSQNPNVYDISEIRTATNNFLSKRHSSSSSSTACWRCDLRNNNTIIFQRKFRRKIEMSQLKEQLSVICRSNHSSVVKLLGASISGDYIYLVYEFIPGANLSNCLRNSKNPNFTVLSTWVSRMQVAADLAYGLDYIHNKTGLNISLVHNHIKSSSIIITEPSFNAKICHFGCAQLCGEADENEMMMKKKSKIGEITELDDDRSLKGSKELARSNSGIMQFEGVRGYMSPEYQATGIATQKSDVYAFGVVLLELLSGKEPYKYKYDKSRGDYMRESVIETARAAIGDRGGLRRWIDGRLKDSFPVEVAEKMTRVGLDCVEVDPDKRPDMGRVAGKISRWYLESRK

HMMPanther: PTHR24420
22-414 FAMILY NOT NAMED,FAMILY NOT NAMED

RTRPTQSPRPTTITTASTSSDPSTSNTINYTTTTSSTLSNRTSLSNLRDSLSQNPNVYDISEIRTATNNFLSKRHSSSSSSTACWRCDLRNNNTIIFQRKFRRKIEMSQLKEQLSVICRSNHSSVVKLLGASISGDYIYLVYEFIPGANLSNCLRNSKNPNFTVLSTWVSRMQVAADLAYGLDYIHNKTGLNISLVHNHIKSSSIIITEPSFNAKICHFGCAQLCGEADENEMMMKKKSKIGEITELDDDRSLKGSKELARSNSGIMQFEGVRGYMSPEYQATGIATQKSDVYAFGVVLLELLSGKEPYKYKYDKSRGDYMRESVIETARAAIGDRGGLRRWIDGRLKDSFPVEVAEKMTRVGLDCVEVDPDKRPDMGRVAGKISRWYLESRK

superfamily: SSF56112
IPR011009
82-425 Protein kinase-like (PK-like)
Protein kinase-like domain

SEIRTATNNFLSKRHSSSSSSTACWRCDLRNNNTIIFQRKFRRKIEMSQLKEQLSVICRSNHSSVVKLLGASISGDYIYLVYEFIPGANLSNCLRNSKNPNFTVLSTWVSRMQVAADLAYGLDYIHNKTGLNISLVHNHIKSSSIIITEPSFNAKICHFGCAQLCGEADENEMMMKKKSKIGEITELDDDRSLKGSKELARSNSGIMQFEGVRGYMSPEYQATGIATQKSDVYAFGVVLLELLSGKEPYKYKYDKSRGDYMRESVIETARAAIGDRGGLRRWIDGRLKDSFPVEVAEKMTRVGLDCVEVDPDKRPDMGRVAGKISRWYLESRKWAEDLRFSDQI

ProfileScan: PS50011
IPR000719
91-409 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

FLSKRHSSSSSSTACWRCDLRNNNTIIFQRKFRRKIEMSQLKEQLSVICRSNHSSVVKLLGASISGDYIYLVYEFIPGANLSNCLRNSKNPNFTVLSTWVSRMQVAADLAYGLDYIHNKTGLNISLVHNHIKSSSIIITEPSFNAKICHFGCAQLCGEADENEMMMKKKSKIGEITELDDDRSLKGSKELARSNSGIMQFEGVRGYMSPEYQATGIATQKSDVYAFGVVLLELLSGKEPYKYKYDKSRGDYMRESVIETARAAIGDRGGLRRWIDGRLKDSFPVEVAEKMTRVGLDCVEVDPDKRPDMGRVAGKISRWY

HMMSmart: SM00220
IPR002290
91-409 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

FLSKRHSSSSSSTACWRCDLRNNNTIIFQRKFRRKIEMSQLKEQLSVICRSNHSSVVKLLGASISGDYIYLVYEFIPGANLSNCLRNSKNPNFTVLSTWVSRMQVAADLAYGLDYIHNKTGLNISLVHNHIKSSSIIITEPSFNAKICHFGCAQLCGEADENEMMMKKKSKIGEITELDDDRSLKGSKELARSNSGIMQFEGVRGYMSPEYQATGIATQKSDVYAFGVVLLELLSGKEPYKYKYDKSRGDYMRESVIETARAAIGDRGGLRRWIDGRLKDSFPVEVAEKMTRVGLDCVEVDPDKRPDMGRVAGKISRWY

Seg: seg
97-102 seg

SSSSSS

HMMPfam: PF00069
IPR017442
105-398 Pkinase,Ser-thr
Serine/threonine-protein kinase-like domain

CWRCDLRNNNTIIFQRKFRRKIEMSQLKEQLSVICRSNHSSVVKLLGASISGDYIYLVYEFIPGANLSNCLRNSKNPNFTVLSTWVSRMQVAADLAYGLDYIHNKTGLNISLVHNHIKSSSIIITEPSFNAKICHFGCAQLCGEADENEMMMKKKSKIGEITELDDDRSLKGSKELARSNSGIMQFEGVRGYMSPEYQATGIATQKSDVYAFGVVLLELLSGKEPYKYKYDKSRGDYMRESVIETARAAIGDRGGLRRWIDGRLKDSFPVEVAEKMTRVGLDCVEVDPDKRPDM

Gene3D: G3DSA:3.30.200.20
115-165 no description

TIIFQRKFRRKIEMSQLKEQLSVICRSNHSSVVKLLGASISGDYIYLVYEF

HMMSmart: SM00219
IPR020635
116-405 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

IIFQRKFRRKIEMSQLKEQLSVICRSNHSSVVKLLGASISGDYIYLVYEFIPGANLSNCLRNSKNPNFTVLSTWVSRMQVAADLAYGLDYIHNKTGLNISLVHNHIKSSSIIITEPSFNAKICHFGCAQLCGEADENEMMMKKKSKIGEITELDDDRSLKGSKELARSNSGIMQFEGVRGYMSPEYQATGIATQKSDVYAFGVVLLELLSGKEPYKYKYDKSRGDYMRESVIETARAAIGDRGGLRRWIDGRLKDSFPVEVAEKMTRVGLDCVEVDPDKRPDMGRVAGKI

Gene3D: G3DSA:1.10.510.10
289-400 no description

QFEGVRGYMSPEYQATGIATQKSDVYAFGVVLLELLSGKEPYKYKYDKSRGDYMRESVIETARAAIGDRGGLRRWIDGRLKDSFPVEVAEKMTRVGLDCVEVDPDKRPDMGR






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox