PRGDB00075182 (Pth.5168)

From PRG Wiki
Jump to: navigation, search
Pth.5168
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 224135632 (XM_002322086)
Gene Class RLP
Domain Type Ser-Thr Kinase, LRR
Gene Species Populus trichocarpa

Comment?

Populus trichocarpa predicted protein, mRNA

DNA Sequence

ATGTTACCCGTATTTTTCACTTCGATCCTCATTCTTTCAATTCAACCCTCCCTTCCAAAAAATCTCTCACCCGACCATTCAGCCCTCCTCAGCCTCCGGTCTGCCGTGCACGGCCGGACACTCCTCTGGAACGTTTCGCTGCAGAGCCCTTGTTCATGGACTGGTGTCAAATGTGAACAAAATCGTGTCACGGTTCTCCGGCTTCCTGGTTTTGCACTCACTGGAGAAATCCCACTTGGAATCTTCTCAAACTTGACACAATTACGCACTTTGAGTCTTAGGCTTAATGCACTTACTGGAAACCTTCCTCAAGATCTTTCTAATTGTAAAAGTCTAAGGAATCTTTATTTACAAGGGAATCTTTTCTCTGGAGAGATTCCTGATTTCCTGTTTAGTTTGAAAGATCTTGTGAGGTTGAACCTTGCTGAGAATAATTTCACCGGTGAAATTTCACCCGGATTTGACAATTTCACGAGGCTGCGGACTTTGTTTTTGGAGGATAATTTGTTAACCGGGTCATTGCCAGATTTGAAGCTGGAGAAGCTAAAGCAGTTTAATGTAAGTAATAATTTGTTAAATGGGTCTATACCTGATACATTTAAAGGTTTTGGACCTAGTTCTTTTGGGGGTACTTCTTTATGTGGGAAGCCTCTTCCTGATTGTAAAGATAGCGGGGGGGCTATTGTGGTGCCTAGTACACCAAATGGTGGTGGACAAGGTAAGAGGAAGAAGTTGTCTGGAGGTGCAATTGCAGGTATTGTGATTGGGTCTATAGTGGGGTTACTGTTGATTGTTATGATTTTGATGTTTTTGTGTAGAAAGAACAGTAGTAATAAGTCAAGATCGATTGACATTGCATCGATTAAACAACAAGAGATGGAGATTCAAGGGGATAAGCCAATTGTCGAGGCGGAGAATGGTGGAGGGTATGGAAATGGGTATTCTGTGGCCGCCGCGGCGGCGGCTGCAATGGTGGGTAATGGTAAAGGTGGGGACTTGAATAGTGGTGGTGCCAAAAAGTTGGTGTTTTTCGGCAAGGCACCAAGGGTGTTTGATTTAGAAGATTTGTTGAGAGCCTCTGCAGAGGTTTTGGGGAAAGGTACGTTTGGGACGGCGTACAAGGCAGTTTTGGAGATGGGAACTGTGGTGGCTGTGAAGAGGTTGAGGGATGTGACAATTTCTGAGATAGAATTTAGGGAGAAGATCGAGACTGTGGGTGCTATGGATCATGAGAATTTGGTCCCATTGAGAGCTTACTATTATAGCAGAGATGAGAAGCTTCTTGTTTATGATTACATGTCAATGGGAAGCTTGTCTGCACTTTTGCATGGAAACAAGGGAGCTGGTAGGGCTCCATTGAACTGGGAAATCAGGTCTGGCATTGCCCTTGCAGCTGCCCGTGGCATTGAATACCTGCACTCTCAAGGTCCCAACGTATCCCACGGAAACATCAAGTCATCTAATATCCTTCTTACTCAATCATATGATGCCCGGGTATCTGATTTTGGGCTTGCCCACCTTGTTGGTCCTCCCTCTACTCCTAACCGAGTTGCTGGTTACCGAGCACCTGAGGTAACTGACCCTCGCAAGGTTTCCCAGAAGGCTGATGTATATAGCTTTGGTGTGTTGCTGTTGGAGCTGCTTACCGGGAAGGCCCCCGCCCATGCCCTTTTGAATGAGGAGGGCGTGGACCTTCCCAGATGGGTTCAGTCTATAGTTCGAGAGGAATGGACTTCAGAGGTGTTTGATCTTGAGCTCCTCAGATACCAGAATGTTGAGGAAGAGATGGTTCAGCTCTTGCAGCTTGGAATAGATTGTGCCGCCCAATACCCTGACAACCGCCCATCAATGTCCGCAGTAACAAGGAGGATCGAGGAGCTATGTCGGTCTAGCCTGCGGGAACATCACGGCCCACAGCCTGAACCAAGCAATGATGCAGATGATAACTCATCTCGATGAGCTGGCAACATCAAACCATGTATTGTAGAAGGATCTTCCTTGCTTTGTTTATGCCCATAATTATCATTTTTATTCTGGTGTTTGATTATATGTTTGATCGGGTCATCTTTCATTAGGAGCCAACTGTCATGTTCttttttttttATCTTGCCCCTCACCCCCATTGTACTAATTTTTCCTCCTTTTTTCCATAAATACTGAGGTGGATATCTGTTCTATTTCCTCTTGATGGGTGGA


Protein sequences

Name Description Sequence
Pth.5168 translated coding region predicted by ESTScan from UniGene Pth.5168

XVTRIFHFDPHSFNSTLPSKKSLTRPFSPPQPPVCRARPDTPLERFAAEPLFMDGVKCEQNRVTVLRLPGFALTGEIPLGIFSNLTQLRTLSLRLNALTGNLPQDLSNCKSLRNLYLQGNLFSGEIPDFLFSLKDLVRLNLAENNFTGEISPGFDNFTRLRTLFLEDNLLTGSLPDLKLEKLKQFNVSNNLLNGSIPDTFKGFGPSSFGGTSLCGKPLPDCKDSGGAIVVPSTPNGGGQGKRKKLSGGAIAGIVIGSIVGLLLIVMILMFLCRKNSSNKSRSIDIASIKQQEMEIQGDKPIVEAENGGGYGNGYSVAAAAAAAMVGNGKGGDLNSGGAKKLVFFGKAPRVFDLEDLLRASAEVLGKGTFGTAYKAVLEMGTVVAVKRLRDVTISEIEFREKIETVGAMDHENLVPLRAYYYSRDEKLLVYDYMSMGSLSALLHGNKGAGRAPLNWEIRSGIALAAARGIEYLHSQGPNVSHGNIKSSNILLTQSYDARVSDFGLAHLVGPPSTPNRVAGYRAPEVTDPRKVSQKADVYSFGVLLLELLTGKAPAHALLNEEGVDLPRWVQSIVREEWTSEVFDLELLRYQNVEEEMVQLLQLGIDCAAQYPDNRPSMSAVTRRIEELCRSSLREHHGPQPEPSNDADDNSSR

Domains

Domain Start-End Description Sequence

Gene3D: G3DSA:3.80.10.10
54-203 no description

DGVKCEQNRVTVLRLPGFALTGEIPLGIFSNLTQLRTLSLRLNALTGNLPQDLSNCKSLRNLYLQGNLFSGEIPDFLFSLKDLVRLNLAENNFTGEISPGFDNFTRLRTLFLEDNLLTGSLPDLKLEKLKQFNVSNNLLNGSIPDTFKGF

HMMPanther: PTHR24420:SF537
55-627 SUBFAMILY NOT NAMED

GVKCEQNRVTVLRLPGFALTGEIPLGIFSNLTQLRTLSLRLNALTGNLPQDLSNCKSLRNLYLQGNLFSGEIPDFLFSLKDLVRLNLAENNFTGEISPGFDNFTRLRTLFLEDNLLTGSLPDLKLEKLKQFNVSNNLLNGSIPDTFKGFGPSSFGGTSLCGKPLPDCKDSGGAIVVPSTPNGGGQGKRKKLSGGAIAGIVIGSIVGLLLIVMILMFLCRKNSSNKSRSIDIASIKQQEMEIQGDKPIVEAENGGGYGNGYSVAAAAAAAMVGNGKGGDLNSGGAKKLVFFGKAPRVFDLEDLLRASAEVLGKGTFGTAYKAVLEMGTVVAVKRLRDVTISEIEFREKIETVGAMDHENLVPLRAYYYSRDEKLLVYDYMSMGSLSALLHGNKGAGRAPLNWEIRSGIALAAARGIEYLHSQGPNVSHGNIKSSNILLTQSYDARVSDFGLAHLVGPPSTPNRVAGYRAPEVTDPRKVSQKADVYSFGVLLLELLTGKAPAHALLNEEGVDLPRWVQSIVREEWTSEVFDLELLRYQNVEEEMVQLLQLGIDCAAQYPDNRPSMSAVTRRIEEL

HMMPanther: PTHR24420
55-627 FAMILY NOT NAMED,FAMILY NOT NAMED

GVKCEQNRVTVLRLPGFALTGEIPLGIFSNLTQLRTLSLRLNALTGNLPQDLSNCKSLRNLYLQGNLFSGEIPDFLFSLKDLVRLNLAENNFTGEISPGFDNFTRLRTLFLEDNLLTGSLPDLKLEKLKQFNVSNNLLNGSIPDTFKGFGPSSFGGTSLCGKPLPDCKDSGGAIVVPSTPNGGGQGKRKKLSGGAIAGIVIGSIVGLLLIVMILMFLCRKNSSNKSRSIDIASIKQQEMEIQGDKPIVEAENGGGYGNGYSVAAAAAAAMVGNGKGGDLNSGGAKKLVFFGKAPRVFDLEDLLRASAEVLGKGTFGTAYKAVLEMGTVVAVKRLRDVTISEIEFREKIETVGAMDHENLVPLRAYYYSRDEKLLVYDYMSMGSLSALLHGNKGAGRAPLNWEIRSGIALAAARGIEYLHSQGPNVSHGNIKSSNILLTQSYDARVSDFGLAHLVGPPSTPNRVAGYRAPEVTDPRKVSQKADVYSFGVLLLELLTGKAPAHALLNEEGVDLPRWVQSIVREEWTSEVFDLELLRYQNVEEEMVQLLQLGIDCAAQYPDNRPSMSAVTRRIEEL

superfamily: SSF52058
59-203 L domain-like,LRR

EQNRVTVLRLPGFALTGEIPLGIFSNLTQLRTLSLRLNALTGNLPQDLSNCKSLRNLYLQGNLFSGEIPDFLFSLKDLVRLNLAENNFTGEISPGFDNFTRLRTLFLEDNLLTGSLPDLKLEKLKQFNVSNNLLNGSIPDTFKGF

HMMPfam: PF13855
64-121 LRR_8,Leucine rich repeat

TVLRLPGFALTGEIPLGIFSNLTQLRTLSLRLNALTGNLPQDLSNCKSLRNLYLQGNL

Seg: seg
245-269 seg

LSGGAIAGIVIGSIVGLLLIVMILM

Seg: seg
302-337 seg

VEAENGGGYGNGYSVAAAAAAAMVGNGKGGDLNSGG

superfamily: SSF56112
IPR011009
335-647 Protein kinase-like (PK-like)
Protein kinase-like domain

SGGAKKLVFFGKAPRVFDLEDLLRASAEVLGKGTFGTAYKAVLEMGTVVAVKRLRDVTISEIEFREKIETVGAMDHENLVPLRAYYYSRDEKLLVYDYMSMGSLSALLHGNKGAGRAPLNWEIRSGIALAAARGIEYLHSQGPNVSHGNIKSSNILLTQSYDARVSDFGLAHLVGPPSTPNRVAGYRAPEVTDPRKVSQKADVYSFGVLLLELLTGKAPAHALLNEEGVDLPRWVQSIVREEWTSEVFDLELLRYQNVEEEMVQLLQLGIDCAAQYPDNRPSMSAVTRRIEELCRSSLREHHGPQPEPSNDAD

ProfileScan: PS50011
IPR000719
358-627 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

RASAEVLGKGTFGTAYKAVLEMGTVVAVKRLRDVTISEIEFREKIETVGAMDHENLVPLRAYYYSRDEKLLVYDYMSMGSLSALLHGNKGAGRAPLNWEIRSGIALAAARGIEYLHSQGPNVSHGNIKSSNILLTQSYDARVSDFGLAHLVGPPSTPNRVAGYRAPEVTDPRKVSQKADVYSFGVLLLELLTGKAPAHALLNEEGVDLPRWVQSIVREEWTSEVFDLELLRYQNVEEEMVQLLQLGIDCAAQYPDNRPSMSAVTRRIEEL

HMMSmart: SM00219
IPR020635
358-624 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

RASAEVLGKGTFGTAYKAVLEMGTVVAVKRLRDVTISEIEFREKIETVGAMDHENLVPLRAYYYSRDEKLLVYDYMSMGSLSALLHGNKGAGRAPLNWEIRSGIALAAARGIEYLHSQGPNVSHGNIKSSNILLTQSYDARVSDFGLAHLVGPPSTPNRVAGYRAPEVTDPRKVSQKADVYSFGVLLLELLTGKAPAHALLNEEGVDLPRWVQSIVREEWTSEVFDLELLRYQNVEEEMVQLLQLGIDCAAQYPDNRPSMSAVTRRI

HMMSmart: SM00220
IPR002290
358-628 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

RASAEVLGKGTFGTAYKAVLEMGTVVAVKRLRDVTISEIEFREKIETVGAMDHENLVPLRAYYYSRDEKLLVYDYMSMGSLSALLHGNKGAGRAPLNWEIRSGIALAAARGIEYLHSQGPNVSHGNIKSSNILLTQSYDARVSDFGLAHLVGPPSTPNRVAGYRAPEVTDPRKVSQKADVYSFGVLLLELLTGKAPAHALLNEEGVDLPRWVQSIVREEWTSEVFDLELLRYQNVEEEMVQLLQLGIDCAAQYPDNRPSMSAVTRRIEELC

HMMPfam: PF00069
IPR017442
362-620 Pkinase,Ser-thr
Serine/threonine-protein kinase-like domain

EVLGKGTFGTAYKAVLEMGTVVAVKRLRDVTISEIEFREKIETVGAMDHENLVPLRAYYYSRDEKLLVYDYMSMGSLSALLHGNKGAGRAPLNWEIRSGIALAAARGIEYLHSQGPNVSHGNIKSSNILLTQSYDARVSDFGLAHLVGPPSTPNRVAGYRAPEVTDPRKVSQKADVYSFGVLLLELLTGKAPAHALLNEEGVDLPRWVQSIVREEWTSEVFDLELLRYQNVEEEMVQLLQLGIDCAAQYPDNRPSMSAV

PatternScan: PS00107
IPR017441
364-386 PROTEIN_KINASE_ATP
Protein kinase, ATP binding site

LGKGTFGTAYKAVLEMGTVVAVK

Gene3D: G3DSA:3.30.200.20
364-420 no description

LGKGTFGTAYKAVLEMGTVVAVKRLRDVTISEIEFREKIETVGAMDHENLVPLRAYY

Gene3D: G3DSA:1.10.510.10
421-620 no description

YSRDEKLLVYDYMSMGSLSALLHGNKGAGRAPLNWEIRSGIALAAARGIEYLHSQGPNVSHGNIKSSNILLTQSYDARVSDFGLAHLVGPPSTPNRVAGYRAPEVTDPRKVSQKADVYSFGVLLLELLTGKAPAHALLNEEGVDLPRWVQSIVREEWTSEVFDLELLRYQNVEEEMVQLLQLGIDCAAQYPDNRPSMSAV






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox