PRGDB00075184 (Pth.5270)

From PRG Wiki
Jump to: navigation, search
Pth.5270
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 224060416 (XM_002300153)
Gene Class N
Domain Type NBS
Gene Species Populus trichocarpa

Comment?

Populus trichocarpa white-brown-complex ABC transporter family, mRNA

DNA Sequence

GGTGTTTTCTTGACTTGGGAGGATTTGTGGGTGACTGTTTCCAATGGGAAAAAAGGCAGTAAATCAATCCTTCAGGGCTTAACTGGTTATGCTCAGCCTGGAGAGCTTTTGGCTATAATGGGTCCTTCAGGCTGTGGCAAGTCAACACTTCTTGATACATTGGCAGGGAGACTGGGTTCAAACACACGACAAACAGGAGACATACTAATCAATGGCCACAAACAAAGGCTGGCTTATGGTACATCGGCTTATGTAACTCAAGATGAAACCTTAATCACAACATTAACAGTCAAAGAAGCTGTGTACTACTCAGCTCAGCTCCAATTGCCAGACTCAATGTCAAGGGCAGAAAAGAAAGAGCGAGCAGAGGTGACAATAAGAGAAATGGGGCTGCAAGATGCCATGAATACAAGAATTGGAGGATGGGGATCTAAAGGACTTAGTGGTGGTCAAAAGAGGAGAGTGAGCATTTGCATAGAGATACTAACACATCCGAAACTTCTCTTTCTTGATGAACCCACAAGTGGGCTTGATAGTGCAGCATCATATTATGTCATGAGCCGAATTGTTAGATTTGACCGCAAGGATGAAAATAGAAGAACTGTAATTGCATCCATTCATCAGCCTAGTGGTGAAGTCTTTCAGCTTTTCGACAGTCTTTGCCTGCTCAGTGCTGGTAAAGTAGTGTATTTTGGCCCAGCTTCTCAAGCAAATGAGTTTTTTGCCTTAAATGGCTTTCCTTGCCCGACTCTCCAGAACCCATCTGATCATTTCCTGAAAACCATAAACAAAGATTTCGAAACGGTATGTTGTCTTATCCAAGGTCTGGCTTTGCGGTATCTTTGGTTAATTATCAGATGGATACAGGATTGTGGGACATTAGAGGAAAGAAGCCATTCTAGCTTCCTTACTCAGTGTCTTGTGCTTACAAGAAGATCTTTCGTAAACATGTATCGAGATCTTGGGTACTATTGGTTGCGGGTCGCCATCTATGTCGCATTAGCATTAGGCCTTGCCACTTTGTTTTACAACCTTGGATCTGATAATGATTCAATTCAGGATAGAGGTTCTCTGCTAATGTTCATAGCTTCTTTCTTAACGTTCATGACAATCGGAGGATTCCCTTCTTTTGTGGAAGATATGAAGGTATTTGAAAGAGAAAGGTTAAATGGGCACTATGGTGCCACTGCTTTTGTTTTTGGCAACACATTCTCCGCCTTTCCATACCTGTTACTGATATCAGTAATTCCTGGAGCAATAACTTATTACCTTCCTGGACTTCACAAGGGATATGAACACTTCATATACTTTGTTTTAGTATTGTTTGCTTGCATGATGTTGGTGGAGAGCTTAATGATGACCGTTGCGAGTGTGGTGCCAAATTTTCTGATGGGAATAATAACAGGAGCTGGGATTCAAGCTTTCATGGTTCTAGGTGGGGGGTTCTTTAGATTGCCAAATGATCTCCCTCAGCCATTCTGGAAGTATCCCATGTACTACATTGCCTTCCATAAGTATGCCTACCAAGGAATGTTCAAGAACGAATTTGAAGGACTAACATTTCCTAGCAATCAAGCCGGAGGGCCACGGACGATTCCCGGGGAACAAATTCTGAGAGATCGATGGCAAGTGGAAATGGGTGTCTCCAAGTGGGTTGATCTTGCTATTTTGCTTGGAATGGTGGTTCTATACAGAATTTTGTTCTTGGTTATTATCAAGACCACAGAGAAGATAAAACCT


Protein sequences

Name Description Sequence
Pth.5270 translated coding region predicted by ESTScan from UniGene Pth.5270

GVFLTWEDLWVTVSNGKKGSKSILQGLTGYAQPGELLAIMGPSGCGKSTLLDTLAGRLGSNTRQTGDILINGHKQRLAYGTSAYVTQDETLITTLTVKEAVYYSAQLQLPDSMSRAEKKERAEVTIREMGLQDAMNTRIGGWGSKGLSGGQKRRVSICIEILTHPKLLFLDEPTSGLDSAASYYVMSRIVRFDRKDENRRTVIASIHQPSGEVFQLFDSLCLLSAGKVVYFGPASQANEFFALNGFPCPTLQNPSDHFLKTINKDFETVCCLIQGLALRYLWLIIRWIQDCGTLEERSHSSFLTQCLVLTRRSFVNMYRDLGYYWLRVAIYVALALGLATLFYNLGSDNDSIQDRGSLLMFIASFLTFMTIGGFPSFVEDMKVFERERLNGHYGATAFVFGNTFSAFPYLLLISVIPGAITYYLPGLHKGYEHFIYFVLVLFACMMLVESLMMTVASVVPNFLMGIITGAGIQAFMVLGGGFFRLPNDLPQPFWKYPMYYIAFHKYAYQGMFKNEFEGLTFPSNQAGGPRTIPGEQILRDRWQVEMGVSKWVDLAILLGMVVLYRILFLVIIKTTEKIKP

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR19241:SF20
1-580 PTHR19241:SF20,ATP-BINDING CASSETTE TRANSPORTER PLANT

GVFLTWEDLWVTVSNGKKGSKSILQGLTGYAQPGELLAIMGPSGCGKSTLLDTLAGRLGSNTRQTGDILINGHKQRLAYGTSAYVTQDETLITTLTVKEAVYYSAQLQLPDSMSRAEKKERAEVTIREMGLQDAMNTRIGGWGSKGLSGGQKRRVSICIEILTHPKLLFLDEPTSGLDSAASYYVMSRIVRFDRKDENRRTVIASIHQPSGEVFQLFDSLCLLSAGKVVYFGPASQANEFFALNGFPCPTLQNPSDHFLKTINKDFETVCCLIQGLALRYLWLIIRWIQDCGTLEERSHSSFLTQCLVLTRRSFVNMYRDLGYYWLRVAIYVALALGLATLFYNLGSDNDSIQDRGSLLMFIASFLTFMTIGGFPSFVEDMKVFERERLNGHYGATAFVFGNTFSAFPYLLLISVIPGAITYYLPGLHKGYEHFIYFVLVLFACMMLVESLMMTVASVVPNFLMGIITGAGIQAFMVLGGGFFRLPNDLPQPFWKYPMYYIAFHKYAYQGMFKNEFEGLTFPSNQAGGPRTIPGEQILRDRWQVEMGVSKWVDLAILLGMVVLYRILFLVIIKTTEKIKP

HMMPanther: PTHR19241
1-580 PTHR19241,ATP-BINDING CASSETTE TRANSPORTER

GVFLTWEDLWVTVSNGKKGSKSILQGLTGYAQPGELLAIMGPSGCGKSTLLDTLAGRLGSNTRQTGDILINGHKQRLAYGTSAYVTQDETLITTLTVKEAVYYSAQLQLPDSMSRAEKKERAEVTIREMGLQDAMNTRIGGWGSKGLSGGQKRRVSICIEILTHPKLLFLDEPTSGLDSAASYYVMSRIVRFDRKDENRRTVIASIHQPSGEVFQLFDSLCLLSAGKVVYFGPASQANEFFALNGFPCPTLQNPSDHFLKTINKDFETVCCLIQGLALRYLWLIIRWIQDCGTLEERSHSSFLTQCLVLTRRSFVNMYRDLGYYWLRVAIYVALALGLATLFYNLGSDNDSIQDRGSLLMFIASFLTFMTIGGFPSFVEDMKVFERERLNGHYGATAFVFGNTFSAFPYLLLISVIPGAITYYLPGLHKGYEHFIYFVLVLFACMMLVESLMMTVASVVPNFLMGIITGAGIQAFMVLGGGFFRLPNDLPQPFWKYPMYYIAFHKYAYQGMFKNEFEGLTFPSNQAGGPRTIPGEQILRDRWQVEMGVSKWVDLAILLGMVVLYRILFLVIIKTTEKIKP

superfamily: SSF52540
3-254 SSF52540

FLTWEDLWVTVSNGKKGSKSILQGLTGYAQPGELLAIMGPSGCGKSTLLDTLAGRLGSNTRQTGDILINGHKQRLAYGTSAYVTQDETLITTLTVKEAVYYSAQLQLPDSMSRAEKKERAEVTIREMGLQDAMNTRIGGWGSKGLSGGQKRRVSICIEILTHPKLLFLDEPTSGLDSAASYYVMSRIVRFDRKDENRRTVIASIHQPSGEVFQLFDSLCLLSAGKVVYFGPASQANEFFALNGFPCPTLQNP

ProfileScan: PS50893
IPR003439
4-250 ABC_TRANSPORTER_2
ABC transporter-like

LTWEDLWVTVSNGKKGSKSILQGLTGYAQPGELLAIMGPSGCGKSTLLDTLAGRLGSNTRQTGDILINGHKQRLAYGTSAYVTQDETLITTLTVKEAVYYSAQLQLPDSMSRAEKKERAEVTIREMGLQDAMNTRIGGWGSKGLSGGQKRRVSICIEILTHPKLLFLDEPTSGLDSAASYYVMSRIVRFDRKDENRRTVIASIHQPSGEVFQLFDSLCLLSAGKVVYFGPASQANEFFALNGFPCPT

Gene3D: G3DSA:3.40.50.300
5-237 G3DSA:3.40.50.300

TWEDLWVTVSNGKKGSKSILQGLTGYAQPGELLAIMGPSGCGKSTLLDTLAGRLGSNTRQTGDILINGHKQRLAYGTSAYVTQDETLITTLTVKEAVYYSAQLQLPDSMSRAEKKERAEVTIREMGLQDAMNTRIGGWGSKGLSGGQKRRVSICIEILTHPKLLFLDEPTSGLDSAASYYVMSRIVRFDRKDENRRTVIASIHQPSGEVFQLFDSLCLLSAGKVVYFGPASQA

HMMSmart: SM00382
IPR003593
33-235 AAA,NBS
ATPase, AAA+ type, core

PGELLAIMGPSGCGKSTLLDTLAGRLGSNTRQTGDILINGHKQRLAYGTSAYVTQDETLITTLTVKEAVYYSAQLQLPDSMSRAEKKERAEVTIREMGLQDAMNTRIGGWGSKGLSGGQKRRVSICIEILTHPKLLFLDEPTSGLDSAASYYVMSRIVRFDRKDENRRTVIASIHQPSGEVFQLFDSLCLLSAGKVVYFGPAS

HMMPfam: PF00005
IPR003439
48-175 ABC_tran
ABC transporter-like

STLLDTLAGRLGSNTRQTGDILINGHKQRLAYGTSAYVTQDETLITTLTVKEAVYYSAQLQLPDSMSRAEKKERAEVTIREMGLQDAMNTRIGGWGSKGLSGGQKRRVSICIEILTHPKLLFLDEPTS

PatternScan: PS00211
IPR017871
147-161 ABC_TRANSPORTER_1
ABC transporter, conserved site

LSGGQKRRVSICIEI

HMMPfam: PF01061
IPR013525
304-516 ABC2_membrane
ABC-2 type transporter

TQCLVLTRRSFVNMYRDLGYYWLRVAIYVALALGLATLFYNLGSDNDSIQDRGSLLMFIASFLTFMTIGGFPSFVEDMKVFERERLNGHYGATAFVFGNTFSAFPYLLLISVIPGAITYYLPGLHKGYEHFIYFVLVLFACMMLVESLMMTVASVVPNFLMGIITGAGIQAFMVLGGGFFRLPNDLPQPFWKYPMYYIAFHKYAYQGMFKNEF






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox