PRGDB00075185 (Pth.5292)

From PRG Wiki
Jump to: navigation, search
Pth.5292
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 224082289 (XM_002335453)
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Populus trichocarpa

Comment?

Populus trichocarpa predicted protein, mRNA

DNA Sequence

CTGCAAGTGTTCAGTTTTGAAAGCATTAAAGCAGCTACAAATAACTTTTCAAGAGAAAACCAGCTTGGAGAGGGTGGGTTTGGCCCTGTTTATAAGGGTAAATTACCAAGAGGCCTGGAAATAGCAGTGAAGAGGCTGTCAGCATCATCAACTCAAGGACTTGAAGAGTTCAAGAACGAGGTTTCGCTTACGGCTAGACTTCAACATGTAAATCTAGTTAGGCTTCTGGGATTTTGCTCCGAGAGGGGAGAGAAGATGCTAATATACGAGTACATGCCAAATAAAAGCTTGGATCTCTACCTCTTTGATCCAATTAGAAGGTATAGCTTGGATTGGAGTAAGCGGGTTCGTATCATTGAAGGGGTTACTCAAGGGCTTCTATACCTCCAAGAGTACTCAAATTTTACAATAATTCATCGAGATTTGAAATCTAGCAACATTTTACTAGACGATGAAATGAATCCAAAGATATCAGATTTTGGCATGGCTAAACTTTTCAGGAAAGATGTGTATGAAGCAAACACAAGCAGAATTGTTGGAACTTACGGCTATATTCCTCCTGAATATGCGAGGAAAGGCATATATTCCATAAAGTATGATGTTTATAGCTTTGGAGTTGTCCTACTTCAAATGATAAGTGGAAAGACGAATACACGTTTTTACAGCGAAAACGAAGACTTGAACCTTTTAGAATATGCATATGACCTGTGGAAAAACGGGCGAGGAATGGAATTCATTGATCCATTTTTGGATGACTCATCCTCACCTTGTAAACTACTGACATGCATGCAAGTTGCTCTGCTGTGTGTCCAAGAAAATCCAGATGCTAGACCAACAATGCTAGAAGCTTTCTCAATGCTCAAAAATGATGATTCCCTGGCTATTGCTACTCCTGAAAGGCCAGGATTTTCAGAAAAAAAGAAAGGGGACATGGAAACTGCATCCTCATCCCAGCAAGTAATGTGTTCATTCAATGATTCGCAAGTTTCCCAATTGGAACCCCGT


Protein sequences

Name Description Sequence
Pth.5292 translated coding region predicted by ESTScan from UniGene Pth.5292

LQVFSFESIKAATNNFSRENQLGEGGFGPVYKGKLPRGLEIAVKRLSASSTQGLEEFKNEVSLTARLQHVNLVRLLGFCSERGEKMLIYEYMPNKSLDLYLFDPIRRYSLDWSKRVRIIEGVTQGLLYLQEYSNFTIIHRDLKSSNILLDDEMNPKISDFGMAKLFRKDVYEANTSRIVGTYGYIPPEYARKGIYSIKYDVYSFGVVLLQMISGKTNTRFYSENEDLNLLEYAYDLWKNGRGMEFIDPFLDDSSSPCKLLTCMQVALLCVQENPDARPTMLEAFSMLKNDDSLAIATPERPGFSEKKKGDMETASSSQQVMCSFNDSQVSQLEPR

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR24420
1-321 PTHR24420,FAMILY NOT NAMED

LQVFSFESIKAATNNFSRENQLGEGGFGPVYKGKLPRGLEIAVKRLSASSTQGLEEFKNEVSLTARLQHVNLVRLLGFCSERGEKMLIYEYMPNKSLDLYLFDPIRRYSLDWSKRVRIIEGVTQGLLYLQEYSNFTIIHRDLKSSNILLDDEMNPKISDFGMAKLFRKDVYEANTSRIVGTYGYIPPEYARKGIYSIKYDVYSFGVVLLQMISGKTNTRFYSENEDLNLLEYAYDLWKNGRGMEFIDPFLDDSSSPCKLLTCMQVALLCVQENPDARPTMLEAFSMLKNDDSLAIATPERPGFSEKKKGDMETASSSQQVM

HMMPanther: PTHR24420:SF430
1-321 PTHR24420:SF430,SUBFAMILY NOT NAMED

LQVFSFESIKAATNNFSRENQLGEGGFGPVYKGKLPRGLEIAVKRLSASSTQGLEEFKNEVSLTARLQHVNLVRLLGFCSERGEKMLIYEYMPNKSLDLYLFDPIRRYSLDWSKRVRIIEGVTQGLLYLQEYSNFTIIHRDLKSSNILLDDEMNPKISDFGMAKLFRKDVYEANTSRIVGTYGYIPPEYARKGIYSIKYDVYSFGVVLLQMISGKTNTRFYSENEDLNLLEYAYDLWKNGRGMEFIDPFLDDSSSPCKLLTCMQVALLCVQENPDARPTMLEAFSMLKNDDSLAIATPERPGFSEKKKGDMETASSSQQVM

superfamily: SSF56112
IPR011009
1-287 Kinase_like
Protein kinase-like domain

LQVFSFESIKAATNNFSRENQLGEGGFGPVYKGKLPRGLEIAVKRLSASSTQGLEEFKNEVSLTARLQHVNLVRLLGFCSERGEKMLIYEYMPNKSLDLYLFDPIRRYSLDWSKRVRIIEGVTQGLLYLQEYSNFTIIHRDLKSSNILLDDEMNPKISDFGMAKLFRKDVYEANTSRIVGTYGYIPPEYARKGIYSIKYDVYSFGVVLLQMISGKTNTRFYSENEDLNLLEYAYDLWKNGRGMEFIDPFLDDSSSPCKLLTCMQVALLCVQENPDARPTMLEAFSML

Gene3D: G3DSA:3.30.200.20
2-78 G3DSA:3.30.200.20

QVFSFESIKAATNNFSRENQLGEGGFGPVYKGKLPRGLEIAVKRLSASSTQGLEEFKNEVSLTARLQHVNLVRLLGF

ProfileScan: PS50011
IPR000719
16-293 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

FSRENQLGEGGFGPVYKGKLPRGLEIAVKRLSASSTQGLEEFKNEVSLTARLQHVNLVRLLGFCSERGEKMLIYEYMPNKSLDLYLFDPIRRYSLDWSKRVRIIEGVTQGLLYLQEYSNFTIIHRDLKSSNILLDDEMNPKISDFGMAKLFRKDVYEANTSRIVGTYGYIPPEYARKGIYSIKYDVYSFGVVLLQMISGKTNTRFYSENEDLNLLEYAYDLWKNGRGMEFIDPFLDDSSSPCKLLTCMQVALLCVQENPDARPTMLEAFSMLKNDDSL

HMMPfam: PF00069
IPR017442
18-284 Pkinase,Ser-thr
Serine/threonine-protein kinase-like domain

RENQLGEGGFGPVYKGKLPRGLEIAVKRLSASSTQGLEEFKNEVSLTARLQHVNLVRLLGFCSERGEKMLIYEYMPNKSLDLYLFDPIRRYSLDWSKRVRIIEGVTQGLLYLQEYSNFTIIHRDLKSSNILLDDEMNPKISDFGMAKLFRKDVYEANTSRIVGTYGYIPPEYARKGIYSIKYDVYSFGVVLLQMISGKTNTRFYSENEDLNLLEYAYDLWKNGRGMEFIDPFLDDSSSPCKLLTCMQVALLCVQENPDARPTMLEAF

Gene3D: G3DSA:1.10.510.10
79-286 G3DSA:1.10.510.10

CSERGEKMLIYEYMPNKSLDLYLFDPIRRYSLDWSKRVRIIEGVTQGLLYLQEYSNFTIIHRDLKSSNILLDDEMNPKISDFGMAKLFRKDVYEANTSRIVGTYGYIPPEYARKGIYSIKYDVYSFGVVLLQMISGKTNTRFYSENEDLNLLEYAYDLWKNGRGMEFIDPFLDDSSSPCKLLTCMQVALLCVQENPDARPTMLEAFSM

PatternScan: PS00108
IPR008271
137-149 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

IIHRDLKSSNILL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox