PRGDB00075189 (Pth.5486)

From PRG Wiki
Jump to: navigation, search
Pth.5486
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 224128763 (XM_002320380)
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Populus trichocarpa

Comment?

Populus trichocarpa predicted protein, mRNA

DNA Sequence

ATGGAAACAGAGAATGGTGAGTATGGAAGGCAAGAACGCATTGCTCTGGTGGCCATTGTGGTGGTGGCTTCACTGACAGTGGCTTCCCTGCTGGTTGCATTTAGTTATTATTGCTATATACGTAACAAGCTCTCCAAACGCCTTAAAAACCACAGTAGGGAAGGGTATGAGGACAAAGGTTGCTTTACAGATCTCGAAGTTGTTGCCGGGAAAGGCCTTAACGTGTTCACATTTAAGCAATTGCATTCAGCTACTGGTGGTTTCAGCAAGTCGAATGTGGTTGGGCATGGTGGGTTTGGATTAGTGTATCGTGGAGTCCTTAGCGATGGAAGGAAAGTTGCAATTAAGTTAATGGACCAAGCAGGGAAGCAGGGGGAAGATGAATTTAAAGTGGAGGTGGAATTGCTGAGCCACCTGCATTCTCCTTATCTGCTGGCATTGCTTGGGTATTGTTCAGGTGACAATCATAAAGTGCTGGTGTATGAGTTCATGCCAAATGGTGGTCTGCAAGAACATTTGCATCGTATCACTAGTTCCAATACTGTTTCCATAAGTTTGGACTGGGAAACACGTTTGAGAATTGCCCTCGAAGCTGCTAAGGGTTTGGAATATCTCCATGAGCATGTTAATCCTCCAGTGATTCATAGAGATTTTAAAAGCAGCAACATCCTCCTGGACAGAAATTTACACGCCAAAGTTTCTGATTTTGGATTGGCCAAGCTTGGACCTGACAAAGCTGGTGGACATGTTTCTACTAGAGTGCTGGGCACCCAGGGATATATCGCCCCTGAGTACGCATTAACTGGCCATTTGACAACAAAATCAGATGTCTACAGTTATGGGGTTGTTCTCTTGGAATTGCTTACTGGCAGAGTTCCAGTCGATATTAAGAGACCTGCTGGGGAAGGAGTTCTGGTATCTTGGGCACTGCCACGGTTGACAGATAGAGAGAAGGTTGTGGAAATTATGGATCCGGCATTGGAGGGCCAGTATTCAATGAAAGAGGTTATTCAGGTGGCAGCAATTGCTGCAATGTGTGTGCAACCAGAGGCAGATTACAGACCGTTGATGGCAGATGTTGTGCAGTCACTTGTACCACTGGTAAAAACGCAGCGGTCAACTTCAAAGGTAGGAAGCTGCTCGAAT


Protein sequences

Name Description Sequence
Pth.5486 translated coding region predicted by ESTScan from UniGene Pth.5486

METENGEYGRQERIALVAIVVVASLTVASLLVAFSYYCYIRNKLSKRLKNHSREGYEDKGCFTDLEVVAGKGLNVFTFKQLHSATGGFSKSNVVGHGGFGLVYRGVLSDGRKVAIKLMDQAGKQGEDEFKVEVELLSHLHSPYLLALLGYCSGDNHKVLVYEFMPNGGLQEHLHRITSSNTVSISLDWETRLRIALEAAKGLEYLHEHVNPPVIHRDFKSSNILLDRNLHAKVSDFGLAKLGPDKAGGHVSTRVLGTQGYIAPEYALTGHLTTKSDVYSYGVVLLELLTGRVPVDIKRPAGEGVLVSWALPRLTDREKVVEIMDPALEGQYSMKEVIQVAAIAAMCVQPEADYRPLMADVVQSLVPLVKTQRSTSKVGSCSN

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR24420
10-376 PTHR24420,FAMILY NOT NAMED

RQERIALVAIVVVASLTVASLLVAFSYYCYIRNKLSKRLKNHSREGYEDKGCFTDLEVVAGKGLNVFTFKQLHSATGGFSKSNVVGHGGFGLVYRGVLSDGRKVAIKLMDQAGKQGEDEFKVEVELLSHLHSPYLLALLGYCSGDNHKVLVYEFMPNGGLQEHLHRITSSNTVSISLDWETRLRIALEAAKGLEYLHEHVNPPVIHRDFKSSNILLDRNLHAKVSDFGLAKLGPDKAGGHVSTRVLGTQGYIAPEYALTGHLTTKSDVYSYGVVLLELLTGRVPVDIKRPAGEGVLVSWALPRLTDREKVVEIMDPALEGQYSMKEVIQVAAIAAMCVQPEADYRPLMADVVQSLVPLVKTQRSTSK

HMMPanther: PTHR24420:SF882
10-376 PTHR24420:SF882

RQERIALVAIVVVASLTVASLLVAFSYYCYIRNKLSKRLKNHSREGYEDKGCFTDLEVVAGKGLNVFTFKQLHSATGGFSKSNVVGHGGFGLVYRGVLSDGRKVAIKLMDQAGKQGEDEFKVEVELLSHLHSPYLLALLGYCSGDNHKVLVYEFMPNGGLQEHLHRITSSNTVSISLDWETRLRIALEAAKGLEYLHEHVNPPVIHRDFKSSNILLDRNLHAKVSDFGLAKLGPDKAGGHVSTRVLGTQGYIAPEYALTGHLTTKSDVYSYGVVLLELLTGRVPVDIKRPAGEGVLVSWALPRLTDREKVVEIMDPALEGQYSMKEVIQVAAIAAMCVQPEADYRPLMADVVQSLVPLVKTQRSTSK

superfamily: SSF56112
IPR011009
58-364 Kinase_like
Protein kinase-like domain

DKGCFTDLEVVAGKGLNVFTFKQLHSATGGFSKSNVVGHGGFGLVYRGVLSDGRKVAIKLMDQAGKQGEDEFKVEVELLSHLHSPYLLALLGYCSGDNHKVLVYEFMPNGGLQEHLHRITSSNTVSISLDWETRLRIALEAAKGLEYLHEHVNPPVIHRDFKSSNILLDRNLHAKVSDFGLAKLGPDKAGGHVSTRVLGTQGYIAPEYALTGHLTTKSDVYSYGVVLLELLTGRVPVDIKRPAGEGVLVSWALPRLTDREKVVEIMDPALEGQYSMKEVIQVAAIAAMCVQPEADYRPLMADVVQSL

Gene3D: G3DSA:3.30.200.20
71-149 G3DSA:3.30.200.20

KGLNVFTFKQLHSATGGFSKSNVVGHGGFGLVYRGVLSDGRKVAIKLMDQAGKQGEDEFKVEVELLSHLHSPYLLALLG

ProfileScan: PS50011
IPR000719
88-368 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

FSKSNVVGHGGFGLVYRGVLSDGRKVAIKLMDQAGKQGEDEFKVEVELLSHLHSPYLLALLGYCSGDNHKVLVYEFMPNGGLQEHLHRITSSNTVSISLDWETRLRIALEAAKGLEYLHEHVNPPVIHRDFKSSNILLDRNLHAKVSDFGLAKLGPDKAGGHVSTRVLGTQGYIAPEYALTGHLTTKSDVYSYGVVLLELLTGRVPVDIKRPAGEGVLVSWALPRLTDREKVVEIMDPALEGQYSMKEVIQVAAIAAMCVQPEADYRPLMADVVQSLVPLV

HMMPfam: PF00069
IPR017442
90-362 Pkinase,Ser-thr
Serine/threonine-protein kinase-like domain

KSNVVGHGGFGLVYRGVLSDGRKVAIKLMDQAGKQGEDEFKVEVELLSHLHSPYLLALLGYCSGDNHKVLVYEFMPNGGLQEHLHRITSSNTVSISLDWETRLRIALEAAKGLEYLHEHVNPPVIHRDFKSSNILLDRNLHAKVSDFGLAKLGPDKAGGHVSTRVLGTQGYIAPEYALTGHLTTKSDVYSYGVVLLELLTGRVPVDIKRPAGEGVLVSWALPRLTDREKVVEIMDPALEGQYSMKEVIQVAAIAAMCVQPEADYRPLMADVVQ

PatternScan: PS00107
IPR017441
94-116 PROTEIN_KINASE_ATP
Protein kinase, ATP binding site

VGHGGFGLVYRGVLSDGRKVAIK

Gene3D: G3DSA:1.10.510.10
150-364 G3DSA:1.10.510.10

YCSGDNHKVLVYEFMPNGGLQEHLHRITSSNTVSISLDWETRLRIALEAAKGLEYLHEHVNPPVIHRDFKSSNILLDRNLHAKVSDFGLAKLGPDKAGGHVSTRVLGTQGYIAPEYALTGHLTTKSDVYSYGVVLLELLTGRVPVDIKRPAGEGVLVSWALPRLTDREKVVEIMDPALEGQYSMKEVIQVAAIAAMCVQPEADYRPLMADVVQSL

PatternScan: PS00108
IPR008271
213-225 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

VIHRDFKSSNILL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox