PRGDB00075190 (Pth.5607)

From PRG Wiki
Jump to: navigation, search
Pth.5607
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 224093265 (XM_002309822)
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Populus trichocarpa

Comment?

Populus trichocarpa predicted protein, mRNA

DNA Sequence

ATGTATGATAACATTGAAGAATTCTTGCAAAGTCATGATCATAATCTCACGCTTATAAGGTACTCTTACTCGGAGATTAAGAAGATAACTCATGGATTCAATGATAAGTTAGGTGAAGGAGGTTATGGCTCGGTGTACAAAGGAAAGCTTCGTAGTGGCCGTTTTGCGGCTGTAAAAATTTTGCGCAAAGAAAAGGCTAATGGGCAAGATTTTATCAATGAAGTTGCCACCATTGGAAGAATTCACCATTGCAATGTGGTGTTGCTCATAGGCTTTACTGTTGAGGGCTCGAAGCGTGCTCTTATATATGAGTTCATGCCTAATGGATCTCTTGAAAAATATATTTTTTCTAGGCAAGGTAGCATACCGCTGAGCAACCAGAAAATATATGAAATTTCTCTTGGGGTGGCTCGTGGCATTGAATATCTACATGAAGGTTGTGACATGCAGATTTTGCATTTTGACATCAAGCCTCACAACATTCTTCTCGATGAAAATTTCACTCCAAAAGTCTCAGATTTTGGACTTGCAAAATTGTATCCAACTAATAATAGCATTGTGTCCCTTACTATGGCTAGAGGAACAATGGGATACATGGCTCCTGAGTTATTTTACAAAAGTATCGGAGGCGTCTCTTACAAAGCCGATGTCTATAGTTTTGGGATGTTATTGATGGAAATGGTTGGGAGAAGGAAAAATCTGAATGCATTAGCAGATCATTCAAGTCAGATGTACTTCCCTTCATGGATTTATGATCAGGTTAATAAAGGAAAGGATATACTTGAAGATCAAGCGACAGAGCATGAAAAGAACACAATAAAAAAGATGACTATAGTGGCATTATGGTGCATACAATTGAAGCCTATTGATCGTCCCTCGATGCATAGAGTTGTACAGATGCTTGAAGCGGATCTTGAATCTCTACAAATGCCTCCTAAGCCTTTTCTCGTTCCACAACAGACATCAAATGATGATAGGATCAATATGGCTAATCCAACAAGTTTAAGAGATTCATCGAATGTTTGTAGCATCGATTCTTCATATCAATTTGGTCGTTGA


Protein sequences

Name Description Sequence
Pth.5607 translated coding region predicted by ESTScan from UniGene Pth.5607

MYDNIEEFLQSHDHNLTLIRYSYSEIKKITHGFNDKLGEGGYGSVYKGKLRSGRFAAVKILRKEKANGQDFINEVATIGRIHHCNVVLLIGFTVEGSKRALIYEFMPNGSLEKYIFSRQGSIPLSNQKIYEISLGVARGIEYLHEGCDMQILHFDIKPHNILLDENFTPKVSDFGLAKLYPTNNSIVSLTMARGTMGYMAPELFYKSIGGVSYKADVYSFGMLLMEMVGRRKNLNALADHSSQMYFPSWIYDQVNKGKDILEDQATEHEKNTIKKMTIVALWCIQLKPIDRPSMHRVVQMLEADLESLQMPPKPFLVPQQTSNDDRINMANPTSLRDSSNVCSIDSSYQFGR

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR24420:SF441
3-352 PTHR24420:SF441,SUBFAMILY NOT NAMED

DNIEEFLQSHDHNLTLIRYSYSEIKKITHGFNDKLGEGGYGSVYKGKLRSGRFAAVKILRKEKANGQDFINEVATIGRIHHCNVVLLIGFTVEGSKRALIYEFMPNGSLEKYIFSRQGSIPLSNQKIYEISLGVARGIEYLHEGCDMQILHFDIKPHNILLDENFTPKVSDFGLAKLYPTNNSIVSLTMARGTMGYMAPELFYKSIGGVSYKADVYSFGMLLMEMVGRRKNLNALADHSSQMYFPSWIYDQVNKGKDILEDQATEHEKNTIKKMTIVALWCIQLKPIDRPSMHRVVQMLEADLESLQMPPKPFLVPQQTSNDDRINMANPTSLRDSSNVCSIDSSYQFGR

superfamily: SSF56112
IPR011009
3-301 Kinase_like
Protein kinase-like domain

DNIEEFLQSHDHNLTLIRYSYSEIKKITHGFNDKLGEGGYGSVYKGKLRSGRFAAVKILRKEKANGQDFINEVATIGRIHHCNVVLLIGFTVEGSKRALIYEFMPNGSLEKYIFSRQGSIPLSNQKIYEISLGVARGIEYLHEGCDMQILHFDIKPHNILLDENFTPKVSDFGLAKLYPTNNSIVSLTMARGTMGYMAPELFYKSIGGVSYKADVYSFGMLLMEMVGRRKNLNALADHSSQMYFPSWIYDQVNKGKDILEDQATEHEKNTIKKMTIVALWCIQLKPIDRPSMHRVVQML

HMMPanther: PTHR24420
3-352 PTHR24420,FAMILY NOT NAMED

DNIEEFLQSHDHNLTLIRYSYSEIKKITHGFNDKLGEGGYGSVYKGKLRSGRFAAVKILRKEKANGQDFINEVATIGRIHHCNVVLLIGFTVEGSKRALIYEFMPNGSLEKYIFSRQGSIPLSNQKIYEISLGVARGIEYLHEGCDMQILHFDIKPHNILLDENFTPKVSDFGLAKLYPTNNSIVSLTMARGTMGYMAPELFYKSIGGVSYKADVYSFGMLLMEMVGRRKNLNALADHSSQMYFPSWIYDQVNKGKDILEDQATEHEKNTIKKMTIVALWCIQLKPIDRPSMHRVVQMLEADLESLQMPPKPFLVPQQTSNDDRINMANPTSLRDSSNVCSIDSSYQFGR

Gene3D: G3DSA:3.30.200.20
19-105 G3DSA:3.30.200.20

IRYSYSEIKKITHGFNDKLGEGGYGSVYKGKLRSGRFAAVKILRKEKANGQDFINEVATIGRIHHCNVVLLIGFTVEGSKRALIYEF

ProfileScan: PS50011
IPR000719
31-316 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

HGFNDKLGEGGYGSVYKGKLRSGRFAAVKILRKEKANGQDFINEVATIGRIHHCNVVLLIGFTVEGSKRALIYEFMPNGSLEKYIFSRQGSIPLSNQKIYEISLGVARGIEYLHEGCDMQILHFDIKPHNILLDENFTPKVSDFGLAKLYPTNNSIVSLTMARGTMGYMAPELFYKSIGGVSYKADVYSFGMLLMEMVGRRKNLNALADHSSQMYFPSWIYDQVNKGKDILEDQATEHEKNTIKKMTIVALWCIQLKPIDRPSMHRVVQMLEADLESLQMPPKPFL

HMMPfam: PF00069
IPR017442
34-299 Pkinase,Ser-thr
Serine/threonine-protein kinase-like domain

NDKLGEGGYGSVYKGKLRSGRFAAVKILRKEKANGQDFINEVATIGRIHHCNVVLLIGFTVEGSKRALIYEFMPNGSLEKYIFSRQGSIPLSNQKIYEISLGVARGIEYLHEGCDMQILHFDIKPHNILLDENFTPKVSDFGLAKLYPTNNSIVSLTMARGTMGYMAPELFYKSIGGVSYKADVYSFGMLLMEMVGRRKNLNALADHSSQMYFPSWIYDQVNKGKDILEDQATEHEKNTIKKMTIVALWCIQLKPIDRPSMHRVVQ

PatternScan: PS00107
IPR017441
37-59 PROTEIN_KINASE_ATP
Protein kinase, ATP binding site

LGEGGYGSVYKGKLRSGRFAAVK

Gene3D: G3DSA:1.10.510.10
108-326 G3DSA:1.10.510.10

NGSLEKYIFSRQGSIPLSNQKIYEISLGVARGIEYLHEGCDMQILHFDIKPHNILLDENFTPKVSDFGLAKLYPTNNSIVSLTMARGTMGYMAPELFYKSIGGVSYKADVYSFGMLLMEMVGRRKNLNALADHSSQMYFPSWIYDQVNKGKDILEDQATEHEKNTIKKMTIVALWCIQLKPIDRPSMHRVVQMLEADLESLQMPPKPFLVPQQTSNDDR

PatternScan: PS00108
IPR008271
151-163 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

ILHFDIKPHNILL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox