PRGDB00075341 (Pth.13200)

From PRG Wiki
Jump to: navigation, search
Pth.13200
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 118483505 (EF145498)
Gene Class Mlo-like
Domain Type MLO
Gene Species Populus trichocarpa

Comment?

Populus trichocarpa clone WS01125_F09 unknown mRNA

DNA Sequence

CCGGGGACTACCTTAGAGTATACCCCCACATGGGTTGTGGCTGTGGTTTGCTCTGTTATCGTTCTTATTTCTCTTATTGTTGAAAGAACCCTCCACTACCTTGGCAAGGTCACCCATCATCAACACTCTCTCCCTCCCATATACAACTATATATGTTATGTTGCATGATCAGTGATCAATTCATTTAATCGCCATGAATTGTTCATCTTTCTTGCTGCATATACATGGAAGAGAATTAATACTCATGTGCGCTAGTACTGATCATCGTCCTGATAAATATATTCAATAACGTTTCTATCCCTGGCTGTCTCCAGTTGTTGAAGAGGAAACACCAGAAACCGCTCTTTGAAGCCTTACAGAAAATCAAAGAAGAGTTGATGCTTTTGGGGTTCATATCACTGCTACTAACAGTGTTCCAGGGAAGAATTAACACTATCTGCATTTCTAAAGATTTGTCaaaaaaaaTGCTGCCCTGCAAGGACGAAAGCAAAGAAACCACTACTGCCCATTTTCAGACTTTCTTTTCCTTCGTTCCTGGTGGGATTTCCCGTCGCCTTTTGGCCGAGGCCTCCTCTGCTAATTCTTGTTCCGAGGGAAAGGTTCCAATGTTATCTACAACCGCACTGCATCATCTTCATATATTTATCTTCGTGCTAGCTTGTGTGCATGTGGTTTTCTGTGTTCTAACCATTCTTTTTGGAAGCGCTCGGATAAGGCAGTGGAAACTTTGGGAGGATTCTATCTCAAAAAAGGAACAAGATCCGGAAGAAGCTCAAGGTCCAAAGTTTACTCATGTTAAAGACCATGATTTTATCAAGTCACGATATCTGGGTTTTGGAAAGAATTCCTACATCCTGGGTTGGGTGCATTCATTTTTCAAGCAGTTCTATGCATCTGTAACAAGATCCGATTACACCACGTTGCGACTGGGCTTCATTATGACTCATTGCAGGGGAAACCCGAAGTTTGATTTTCACAAATACATGATGCGAGTCCTCGAAGCTGACTTCAAGAAAGTTGTTGGAATAAGTTGGTATCTTTGGCTATTTGTGGTTATCTTCTTGTGTCTGAACGTTTCTGGTTGGCATGCATATTTCTGGATTGCATTCATACCCTTCATTCTTCTGCTAGCCGTGGGTACTAAGTTGGAGCATGTGATTATCCAATTGGCCCACGAGGTTGCTGAGAAACATGTCGCAGTTCAAGGGGATTTGGTTGTTCGACCTTCAGATGATCACTTCTGGTTCAACAAGCCTAAAATTGTTCTCCTTTTGATTCACATCATTTTATTCCAAAACTCTTTCGAACTGGCATTTTTCTTCTGGATATGGGTGCAGTATGGTTTTGACTCCTGCATAATGGGACAAGTTGGTTATATTATTCCAAGACTTGTTATAGGGGCATTCGTTCAGTTCCTCTGCAGTTACAGTACCCTGCCACTCTATGCCATTGTGACACAGATGGGAAGTTCATTTAAGAGGGAAATATTTGAAGAGCATATTCAAGAAGGGCTTGTGGGTTGGGCTAAGCAAGCAAAGAAGAAGGCAGGGTTGAGAAGGGATGCAAATGAGTCTAGCCATAATCAAGTAGGTCCCAAAGTGGAGTCTCCTCTGATTCAGATGGCAAAAGCTGGATCTAGGGAAACTGCAGTGGAAGAGAACAAATCAGGAGAGATTATACATGGAACTGCCTCCTAAGGAACCACCATGGGAGTCACTCAAGAATCAATGTGCTTGAGCTCTCTAATATATAGTAGTACATACGTTGATAGAGTTGATGTATACAGCTTGAGTGACGTGGGGAAATTTTAAGATTTTAAAATTGAAATTTTAATAAGAGaaaaaaaaaaaaaaaa


Protein sequences

Name Description Sequence
Pth.13200 translated coding region predicted by ESTScan from UniGene Pth.13200

MLPCKDESKETTTAHFQTFFSFVPGGISRRLLAEASSANSCSEGKVPMLSTTALHHLHIFIFVLACVHVVFCVLTILFGSARIRQWKLWEDSISKKEQDPEEAQGPKFTHVKDHDFIKSRYLGFGKNSYILGWVHSFFKQFYASVTRSDYTTLRLGFIMTHCRGNPKFDFHKYMMRVLEADFKKVVGISWYLWLFVVIFLCLNVSGWHAYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHVAVQGDLVVRPSDDHFWFNKPKIVLLLIHIILFQNSFELAFFFWIWVQYGFDSCIMGQVGYIIPRLVIGAFVQFLCSYSTLPLYAIVTQMGSSFKREIFEEHIQEGLVGWAKQAKKKAGLRRDANESSHNQVGPKVESPLIQMAKAGSRETAVEENKSGEIIHGTASXGTTMGVTQESMCLSSLIYSSTYVDRVDVYSLSDVGKF

Domains

Domain Start-End Description Sequence

HMMPfam: PF03094
IPR004326
1-382 Mlo
Mlo-related protein

MLPCKDESKETTTAHFQTFFSFVPGGISRRLLAEASSANSCSEGKVPMLSTTALHHLHIFIFVLACVHVVFCVLTILFGSARIRQWKLWEDSISKKEQDPEEAQGPKFTHVKDHDFIKSRYLGFGKNSYILGWVHSFFKQFYASVTRSDYTTLRLGFIMTHCRGNPKFDFHKYMMRVLEADFKKVVGISWYLWLFVVIFLCLNVSGWHAYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHVAVQGDLVVRPSDDHFWFNKPKIVLLLIHIILFQNSFELAFFFWIWVQYGFDSCIMGQVGYIIPRLVIGAFVQFLCSYSTLPLYAIVTQMGSSFKREIFEEHIQEGLVGWAKQAKKKAGLRRDANESSHNQVGPKVESP






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox