PRGDB00075396 (Pth.15777)

From PRG Wiki
Jump to: navigation, search
Pth.15777
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 118486346 (EF146976)
Gene Class Unknown
Domain Type
Gene Species Populus trichocarpa

Comment?

Populus trichocarpa clone WS01225_L02 unknown mRNA

DNA Sequence

GACTCTTATCTTTCCACTACCTCTCCCTTCCCTTCTCGTCTCACAAGTCAAAAATGGAAAAGAAACCAGTAAACTCAGCAACCCGATCACTTGCCACTCAGCTTCTCTTCCTCATTTCAAGTATTCTCTACACGTGCACTTCGGCCACAGCCCAAGAGCTTCTCGCTGGCTTCAAAGCCAACCCAAGTTCATCAGTCTCATCCTTTCAGTCTCTCTTGAATGACTCAACAAGCACCTTTTCTCTAGGTTTCCTCCGAGTCAACCAAACCCAACTCGCCCTCACAGTCATCCACCTCCCTTCCCTCCAGCCACTCTGGCAGGCTAACCCAACAAGCTCGTTTCGTTGGTCAGACAAGACCCAGCTCTTCTTCAATGGTAGTCTTGTGATATCTGATCCACACAAGAGGTCATTTTGGTCCACAGGAACGTCCCAACAAGGTGACAAAGTTGTCCTCCTGAACTCCTCAAACCTACAAATACTACAAAAACAAGTTGTTCTCTGGCAAAGTTTCGATTTTCCCACAAGTACCCTCGTCGAGAACCAGAATTTCACTTCCAACATGTCTCTCGTCTCCCCCAATGGGCTTTACTCCATGCGCTTAGGAGATGACTTCATGGCCCTATACGCAAGGTTCAAAGATGGGAAAACGCAACAAATGTACTGGAAACACAAAGCCTTGGAAGCTAAAGCAGAAGTTGTTCAAGGACAAGGTCCGATCCATGCCCGACTCGAATCCGATGGGTTTTTGGGCATGTACCAAATGGGAAAAACCCCGGTGGATATTCAACCTTTCAACAGCTTTCATCGACCTATTGACAGATTCCTGATGGTCCAGTTAGAACCGGACGGGAACCTCAAAGGCTATTACTGGGCTCAAACCGACTGGGTCTTGGACTACCAGGCTATCACTGAAACGTGTGAGTTGCCCAGTCCCTGCGGTCCCTACGGTTTGTGCAGAGCCGGGTCGGGCTGCTCCTGCTTGGATAACCGGACCCAGGTGGACACTGCGTCATTTCAGTGCATTGATGGGGATGATCAGTCCGGCGATTTTTGCAGTGGAAGTGATGATTTCTGGGTTCTGAGAAGGAAAGGGGTGGAGTTACCGTTTAAGGAGTTGATGGATTCGGACACAACATCATCATCCGTGGAGGAATGTGAGCTGTCTTGTCAGAGGAACTGCAGCTGCTGGGGTGCAGTTTACAACAACGCAACCGGGTTTTGTTACACTTTGAATTACCCGATCCAAACACTGGTGGGTGTGGGTGATGAGAGTAAAGTCGGGTATTTCAAGGTGAGAACCAAACGTAGTTGGCATAAGAAAATTAAAGTCGGTATTCGGGTTCTTGGGGCGGTTATTGTGGTTCTGACCGGAGTTGTGCTTGGGTATGGAGGTTATAAGATCTGGAATAGGAGAAGAAGAGGGCCTAAACGGGTCTTGGAGGAGAAGACCGAGGTATCACCCGGCCCGTATAAAAATCTCGGGTCGGCTAGTTTCAAGTCTATCGAGATGTTTTAGCAGCAACTTACCaaaaaaaaaaaaaaaa


Protein sequences

Name Description Sequence
Pth.15777 translated coding region predicted by ESTScan from UniGene Pth.15777

MEKKPVNSATRSLATQLLFLISSILYTCTSATAQELLAGFKANPSSSVSSFQSLLNDSTSTFSLGFLRVNQTQLALTVIHLPSLQPLWQANPTSSFRWSDKTQLFFNGSLVISDPHKRSFWSTGTSQQGDKVVLLNSSNLQILQKQVVLWQSFDFPTSTLVENQNFTSNMSLVSPNGLYSMRLGDDFMALYARFKDGKTQQMYWKHKALEAKAEVVQGQGPIHARLESDGFLGMYQMGKTPVDIQPFNSFHRPIDRFLMVQLEPDGNLKGYYWAQTDWVLDYQAITETCELPSPCGPYGLCRAGSGCSCLDNRTQVDTASFQCIDGDDQSGDFCSGSDDFWVLRRKGVELPFKELMDSDTTSSSVEECELSCQRNCSCWGAVYNNATGFCYTLNYPIQTLVGVGDESKVGYFKVRTKRSWHKKIKVGIRVLGAVIVVLTGVVLGYGGYKIWNRRRRGPKRVLEEKTEVSPGPYKNLGSASFKSIEMF

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR11795
30-473 PTHR11795,UNCHARACTERIZED

SATAQELLAGFKANPSSSVSSFQSLLNDSTSTFSLGFLRVNQTQLALTVIHLPSLQPLWQANPTSSFRWSDKTQLFFNGSLVISDPHKRSFWSTGTSQQGDKVVLLNSSNLQILQKQVVLWQSFDFPTSTLVENQNFTSNMSLVSPNGLYSMRLGDDFMALYARFKDGKTQQMYWKHKALEAKAEVVQGQGPIHARLESDGFLGMYQMGKTPVDIQPFNSFHRPIDRFLMVQLEPDGNLKGYYWAQTDWVLDYQAITETCELPSPCGPYGLCRAGSGCSCLDNRTQVDTASFQCIDGDDQSGDFCSGSDDFWVLRRKGVELPFKELMDSDTTSSSVEECELSCQRNCSCWGAVYNNATGFCYTLNYPIQTLVGVGDESKVGYFKVRTKRSWHKKIKVGIRVLGAVIVVLTGVVLGYGGYKIWNRRRRGPKRVLEEKTEVSPGPY

HMMPanther: PTHR11795:SF323
30-473 PTHR11795:SF323

SATAQELLAGFKANPSSSVSSFQSLLNDSTSTFSLGFLRVNQTQLALTVIHLPSLQPLWQANPTSSFRWSDKTQLFFNGSLVISDPHKRSFWSTGTSQQGDKVVLLNSSNLQILQKQVVLWQSFDFPTSTLVENQNFTSNMSLVSPNGLYSMRLGDDFMALYARFKDGKTQQMYWKHKALEAKAEVVQGQGPIHARLESDGFLGMYQMGKTPVDIQPFNSFHRPIDRFLMVQLEPDGNLKGYYWAQTDWVLDYQAITETCELPSPCGPYGLCRAGSGCSCLDNRTQVDTASFQCIDGDDQSGDFCSGSDDFWVLRRKGVELPFKELMDSDTTSSSVEECELSCQRNCSCWGAVYNNATGFCYTLNYPIQTLVGVGDESKVGYFKVRTKRSWHKKIKVGIRVLGAVIVVLTGVVLGYGGYKIWNRRRRGPKRVLEEKTEVSPGPY

ProfileScan: PS50927
IPR001480
39-155 BULB_LECTIN
Bulb-type lectin domain

GFKANPSSSVSSFQSLLNDSTSTFSLGFLRVNQTQLALTVIHLPSLQPLWQANPTSSFRWSDKTQLFFNGSLVISDPHKRSFWSTGTSQQGDKVVLLNSSNLQILQKQVVLWQSFDF

HMMSmart: SM00108
IPR001480
45-156 B_lectin
Bulb-type lectin domain

SSSVSSFQSLLNDSTSTFSLGFLRVNQTQLALTVIHLPSLQPLWQANPTSSFRWSDKTQLFFNGSLVISDPHKRSFWSTGTSQQGDKVVLLNSSNLQILQKQVVLWQSFDFP

superfamily: SSF51110
IPR001480
76-212 B_lectin
Bulb-type lectin domain

LTVIHLPSLQPLWQANPTSSFRWSDKTQLFFNGSLVISDPHKRSFWSTGTSQQGDKVVLLNSSNLQILQKQVVLWQSFDFPTSTLVENQNFTSNMSLVSPNGLYSMRLGDDFMALYARFKDGKTQQMYWKHKALEAK

Gene3D: G3DSA:2.90.10.10
IPR001480
83-206 Bulb-type_lectin_dom
Bulb-type lectin domain

SLQPLWQANPTSSFRWSDKTQLFFNGSLVISDPHKRSFWSTGTSQQGDKVVLLNSSNLQILQKQVVLWQSFDFPTSTLVENQNFTSNMSLVSPNGLYSMRLGDDFMALYARFKDGKTQQMYWKH

HMMPfam: PF01453
IPR001480
86-169 B_lectin
Bulb-type lectin domain

PLWQANPTSSFRWSDKTQLFFNGSLVISDPHKRSFWSTGTSQQGDKVVLLNSSNLQILQKQVVLWQSFDFPTSTLVENQNFTSN

HMMPfam: PF00954
IPR000858
259-311 S_locus_glycop
S-locus glycoprotein

MVQLEPDGNLKGYYWAQTDWVLDYQAITETCELPSPCGPYGLCRAGSGCSCLD

ProfileScan: PS50948
IPR003609
334-416 PAN
Apple-like

CSGSDDFWVLRRKGVELPFKELMDSDTTSSSVEECELSCQRNCSCWGAVYNNATGFCYTLNYPIQTLVGVGDESKVGYFKVRT

HMMPfam: PF08276
IPR013227
334-388 PAN_2
PAN-2 domain

CSGSDDFWVLRRKGVELPFKELMDSDTTSSSVEECELSCQRNCSCWGAVYNNATG






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox