PRGDB00075511 (Ptp.56)

From PRG Wiki
Jump to: navigation, search
Ptp.56
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 60703892 (DN493702)
Gene Class Unknown
Domain Type LRR
Gene Species Populus tremula x Populus tremuloides

Comment?

G115P21.5pR Populus tension wood cDNA library Populus tremula x Populus tremuloides cDNA clone G115P21 5', mRNA sequence

DNA Sequence

GCTGCAGGTCATTGCCGACATCCTCCTCTTAAAAACACAAAAGCTAATACATTCTAGCAATTAAAGACACGTCCTCCGAGCAAAACTCAAAATCACCAGAGATGAGTGCGTTACTCACAACACTAGCTCTCCTCTTCACCCTCATCTACACAGTCACTTCCAGCTGCACTCCATCAGACCTAGCAGCATTACTAGCCTTCAAGTCTTCCCTCAAGGAACCATACTTAGGCATCTTCAACACATGGTCAGGCACTAACTGCTGCTCCAACTGGTACGGCATCAGCTGTGACCCCACCACAGGCAGAGTCGCAGACATCAACCTGCGAGGTGAATCCGAAGACCCCATCTTCGAGAAAGCTGGCAGGTCAGGCTACATGACAGGTTCCATCAACCCCTCAATATGTAAACTTGACAGGCTCTCTACGCTCATTCTGGCAGACTGGAAAGGGGTTTCGGGTGAAATTCCTGGATGTGTTGCTTCTTTAAGTAATCTCCGAATCTTGGATCTTATAGGTAACCAAATATCTGGCAAGATTCCTGCAAATATTGTGAATCTACAGAGACTTACTGTCTTAAACCTTGCTGATAATAGACTCACTGGAGAGATCCCTGCTTCTCTCACAGCTTTGGCAAATATGAAGCATTTGGATCTTAACAGCAATAAGTTGACTGGTCAGTTGCCAGCTGATTTTGGTAACTTGAAAATGCTTAACCGTGCATTGTTGATTAAAAACCACCTGATTGGAGCAATACCAAACTCTATATCGGGCATGTATC


Protein sequences

Name Description Sequence
Ptp.56 translated coding region predicted by ESTScan from UniGene Ptp.56

AAGHCRHPPLKNTKANXILAIKDTSSEQNSKSPEMSALLTTLALLFTLIYTVTSSCTPSDLAALLAFKSSLKEPYLGIFNTWSGTNCCSNWYGISCDPTTGRVADINLRGESEDPIFEKAGRSGYMTGSINPSICKLDRLSTLILADWKGVSGEIPGCVASLSNLRILDLIGNQISGKIPANIVNLQRLTVLNLADNRLTGEIPASLTALANMKHLDLNSNKLTGQLPADFGNLKMLNRALLIKNHLIGAIPNSISGMYX


Domains

Domain Start-End Description Sequence

HMMPanther: PTHR24420
26-258 FAMILY NOT NAMED,FAMILY NOT NAMED

SEQNSKSPEMSALLTTLALLFTLIYTVTSSCTPSDLAALLAFKSSLKEPYLGIFNTWSGTNCCSNWYGISCDPTTGRVADINLRGESEDPIFEKAGRSGYMTGSINPSICKLDRLSTLILADWKGVSGEIPGCVASLSNLRILDLIGNQISGKIPANIVNLQRLTVLNLADNRLTGEIPASLTALANMKHLDLNSNKLTGQLPADFGNLKMLNRALLIKNHLIGAIPNSISGM

HMMPanther: PTHR24420:SF701
26-258 DRT100 (DNA-DAMAGE REPAIR/TOLERATION 100); PROTEIN BINDING

SEQNSKSPEMSALLTTLALLFTLIYTVTSSCTPSDLAALLAFKSSLKEPYLGIFNTWSGTNCCSNWYGISCDPTTGRVADINLRGESEDPIFEKAGRSGYMTGSINPSICKLDRLSTLILADWKGVSGEIPGCVASLSNLRILDLIGNQISGKIPANIVNLQRLTVLNLADNRLTGEIPASLTALANMKHLDLNSNKLTGQLPADFGNLKMLNRALLIKNHLIGAIPNSISGM

Seg: seg
37-48 seg

ALLTTLALLFTL

superfamily: SSF52058
54-258 L domain-like,LRR

SSCTPSDLAALLAFKSSLKEPYLGIFNTWSGTNCCSNWYGISCDPTTGRVADINLRGESEDPIFEKAGRSGYMTGSINPSICKLDRLSTLILADWKGVSGEIPGCVASLSNLRILDLIGNQISGKIPANIVNLQRLTVLNLADNRLTGEIPASLTALANMKHLDLNSNKLTGQLPADFGNLKMLNRALLIKNHLIGAIPNSISGM

Gene3D: G3DSA:3.80.10.10
55-258 no description

SCTPSDLAALLAFKSSLKEPYLGIFNTWSGTNCCSNWYGISCDPTTGRVADINLRGESEDPIFEKAGRSGYMTGSINPSICKLDRLSTLILADWKGVSGEIPGCVASLSNLRILDLIGNQISGKIPANIVNLQRLTVLNLADNRLTGEIPASLTALANMKHLDLNSNKLTGQLPADFGNLKMLNRALLIKNHLIGAIPNSISGM

HMMPfam: PF08263
IPR013210
58-97 LRRNT_2
Leucine-rich repeat-containing N-terminal, type 2

PSDLAALLAFKSSLKEPYLGIFNTWSGTNCCSNWYGISCD

Seg: seg
61-66 seg

LAALLA

HMMPfam: PF12799
164-212 LRR_4,Leucine Rich repeats (2 copies)

NLRILDLIGNQISGKIPANIVNLQRLTVLNLADNRLTGEIPASLTALAN

HMMPfam: PF00560
IPR001611
212-234 LRR_1
Leucine-rich repeat

NMKHLDLNSNKLTGQLPADFGNL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox