PRGDB00075513 (Ptp.192)

From PRG Wiki
Jump to: navigation, search
Ptp.192
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 3852896 (AI161611)
Gene Class TNL
Domain Type NBS, TIR, LRR
Gene Species Populus tremula x Populus tremuloides

Comment?

A003P73U Hybrid aspen plasmid library Populus tremula x Populus tremuloides cDNA 5', mRNA sequence

DNA Sequence

TTTCAAAGAAAGCCGTTGATTACTGTGGAGGACTTCCTTTAGCTCTTCAGGTTATAGGAGCTCTTCTGTACAGGAAAAACAGAGGTGAATGGGAACGTGAAATTGACAACTTGAGCAGAATTCCAAACCAAGATATTCAAGGAAAGCTCTAATAAGTTATGACGCACTTGATGGTGAACTACAAAGAGCATTCCTTGATATTGCATGCTTCTTTATTGGTATAGAGAGAGAATACGTCGCAAAAGTGCTAGGAGTCCGTTGCCGTCCCAATCCAGAAGTTGTTTGGAACTCTCAGTGAAAGGTCTCGATTCCATTTCAGAGTGTACATTAAAGATGAAGGCAGTTATTTGGAGAGTGGTAGCCNGCATGATCTATTACGAGACTGGGAAGGGAGGTTGTTGTAAAGCGTCTCCCTTGCATCTTGGAAAAAGGACAGANTTGGGATTAAGACGTGCTGGGATGTACTGACCACCGGAGGGTACGGTGTTGTAGAGGGCTTGCCTGATGTCAGAGCCTCAGAGCTAA


Protein sequences

Name Description Sequence
Ptp.192 translated coding region predicted by ESTScan from UniGene Ptp.192

XSKKAVDYCGGLPLALQVIGALLYRKNRGEWEREIDNLSRIPNQDIQXKALISYDALDGELQRAFLDIACFFIGIEREYVAKVLGVRCRPNPEVVGTLSERSRFHFRVYIKDEGSYLESGSXHDLLRDWEGRLLXSVSLASWKKDRXGIKTCWDVLTTGGYGVVEGLPDVRASELX


Domains

Domain Start-End Description Sequence

HMMPanther: PTHR11017:SF130
2-84 DISEASE RESISTANCE PROTEIN (TIR-NBS-LRR CLASS), PUTATIVE,DISEASE RESISTANCE PROTEIN (TIR-NBS-LRR CLASS)

SKKAVDYCGGLPLALQVIGALLYRKNRGEWEREIDNLSRIPNQDIQXKALISYDALDGELQRAFLDIACFFIGIEREYVAKVL

HMMPanther: PTHR11017
2-84 FAMILY NOT NAMED,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

SKKAVDYCGGLPLALQVIGALLYRKNRGEWEREIDNLSRIPNQDIQXKALISYDALDGELQRAFLDIACFFIGIEREYVAKVL

HMMPfam: PF00931
IPR002182
3-76 NB-ARC,NBS
NB-ARC

KKAVDYCGGLPLALQVIGALLYRKNRGEWEREIDNLSRIPNQDIQXKALISYDALDGELQRAFLDIACFFIGIE






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox