PRGDB00075515 (Ptp.270)

From PRG Wiki
Jump to: navigation, search
Ptp.270
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 38577610 (CK093285)
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Populus tremula x Populus tremuloides

Comment?

G114P28.3pR Populus tension wood cDNA library Populus tremula x Populus tremuloides cDNA clone G114P28 3', mRNA sequence

DNA Sequence

CCAAAAAAACCTTTTGATGAACAACTTAATCAATATTTCATCCACAGCAACTCTTTTTAATAATATGATGGACCTAAATTCTGCAAAAAGCACCTATTTACCATCTTCGTGTCACAAGCATTGTGTAGAGTTGATAAATATATTGTATTGCCTCAACTAGAAACCAATTTAAATGTCAAAAGACGCAAGGGAAGGAGAGCTGAATGCTGTAGGCTTTTTTCAACTCTGCCAAAACCTCTGCAATGGTTGGCCTTTGCGAGGCATTTTTGTTTACAGACCTTACAGCTACTATAGCTGCCTTTCTCATGCTTTCCACATAAAAAGTTCCCTTTACGTTTTCATCCACTATTTCAAATGCTCCTGCCTGCAAGTAGGGCTTCGCCCATAACACCAAATTGAAGGAATCTGGAGTTCCAAAGCGACGCAATGGTTCTCGCCCGCAGATGAGTTCTACAAAAACAACACCGAAGCTGTAGACGTCGCTTTTCTCTGTAAGCTGTTGGGTAAAATAATATTCGGGATCAAAATACCCTGCAGTGCCCTTGACAACAGTGGTCACATGGGTAGCATCTGCCTGCATAACTTGCTTTAAAAAGGCCAAAGTCACAGACCTTGGCATTCATCTCCTTGTCCAACAAAATATTGCTACACTTCCATCCCCGGTGTATGATTCGTGGGATCACTTGCA


Protein sequences

Name Description Sequence
Ptp.270 translated coding region predicted by ESTScan from UniGene Ptp.270

XQVIPRIIHRGWKCSNILLDKEMNAKAVTLAFLKQVMQADATHVTTVVKGTAGYFDPEYYFTQQLTEKSDVYSFGVVFVELICGREPLRRFGTPDSFNLVLWAKPYLQAGAFEIVDENVKGTFYVESMRKAAIVAVRSVNKNASQRPTIAEVLAELKKAYSIQLSFPCVF

Domains

Domain Start-End Description Sequence

ProfileScan: PS50011
IPR000719
1-161 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

XQVIPRIIHRGWKCSNILLDKEMNAKAVTLAFLKQVMQADATHVTTVVKGTAGYFDPEYYFTQQLTEKSDVYSFGVVFVELICGREPLRRFGTPDSFNLVLWAKPYLQAGAFEIVDENVKGTFYVESMRKAAIVAVRSVNKNASQRPTIAEVLAELKKAYS

HMMPanther: PTHR24420
5-164 FAMILY NOT NAMED,FAMILY NOT NAMED

PRIIHRGWKCSNILLDKEMNAKAVTLAFLKQVMQADATHVTTVVKGTAGYFDPEYYFTQQLTEKSDVYSFGVVFVELICGREPLRRFGTPDSFNLVLWAKPYLQAGAFEIVDENVKGTFYVESMRKAAIVAVRSVNKNASQRPTIAEVLAELKKAYSIQL

HMMPanther: PTHR24420:SF549
5-164 SUBFAMILY NOT NAMED

PRIIHRGWKCSNILLDKEMNAKAVTLAFLKQVMQADATHVTTVVKGTAGYFDPEYYFTQQLTEKSDVYSFGVVFVELICGREPLRRFGTPDSFNLVLWAKPYLQAGAFEIVDENVKGTFYVESMRKAAIVAVRSVNKNASQRPTIAEVLAELKKAYSIQL

superfamily: SSF56112
IPR011009
5-156 Protein kinase-like (PK-like)
Protein kinase-like domain

PRIIHRGWKCSNILLDKEMNAKAVTLAFLKQVMQADATHVTTVVKGTAGYFDPEYYFTQQLTEKSDVYSFGVVFVELICGREPLRRFGTPDSFNLVLWAKPYLQAGAFEIVDENVKGTFYVESMRKAAIVAVRSVNKNASQRPTIAEVLAEL

HMMPfam: PF00069
IPR000719
6-154 Pkinase,Ser-thr
Protein kinase, catalytic domain

RIIHRGWKCSNILLDKEMNAKAVTLAFLKQVMQADATHVTTVVKGTAGYFDPEYYFTQQLTEKSDVYSFGVVFVELICGREPLRRFGTPDSFNLVLWAKPYLQAGAFEIVDENVKGTFYVESMRKAAIVAVRSVNKNASQRPTIAEVLA

Gene3D: G3DSA:1.10.510.10
6-156 no description

RIIHRGWKCSNILLDKEMNAKAVTLAFLKQVMQADATHVTTVVKGTAGYFDPEYYFTQQLTEKSDVYSFGVVFVELICGREPLRRFGTPDSFNLVLWAKPYLQAGAFEIVDENVKGTFYVESMRKAAIVAVRSVNKNASQRPTIAEVLAEL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox