PRGDB00075516 (Ptp.713)

From PRG Wiki
Jump to: navigation, search
Ptp.713
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 38572247 (CK087922)
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Populus tremula x Populus tremuloides

Comment?

A026P46.3pR Hybrid aspen plasmid library Populus tremula x Populus tremuloides cDNA clone A026P46 3', mRNA sequence

DNA Sequence

tttttttttttttttAGCATACAAACATGTAACTTTGTTTTATAATTGAAACAATAAAATATATCATATTTCTATAAGAATAATGAATCAATTACACAACTGCATCCCCCACGGAGTAAGATATCCGAAATGGTATGAAAGCTAAGCTTAAAACAAATGCAGATTATCGTTTTCTTATATAGAAGATACAACAAGCACAATAGAATACCTACAGGGtaaaaaataaataaaaGATTCAATAACTTGGAGAGAGGTAAAATTGTTAGTCACCTAATCCTCCAATTATGTTATCTCCATCTAGTTGGCTGATGATGTTTCCTACCACTTTCACCTTCACTTGTGTCTGAAGTCCCTTCTCCCGATTGCTTATCAATGAATTTCATAGCAGCATGATTCTCTTGTTCATAATCATGCTGTGAATGGGAAGGTTCTCTCCCAACTCGACGTTCATCACGAAATAGCAAGTCATCAGCCTCAAGCATGTGGATTACGTGTCCCATTTTGGGCCTCTTTGTAGCATCAGGATCGACACATTTAAGAGCTACCAGGAGAGCACGTTTTAATGCTTTTGAAGCAGGCATCTCGGGTAACTTGGGATCAACCACTTCTTCAGATTTTCGGTTCCCAACCATAGTTTTTAACCATTCTACCAGATTCACCTCTCCTTGTGGCCGACTATAATCAACAGGGCTTCTCCCAGAAATTATCTCCATGATAAGTATACCGAAACTATAAACATCACTCTTCTCATTCAGCATTCCAGTGCAAGCATATTCTGGAGCAACATAACCAAATGTTCCCATCACACGCGTTGGGACATAACTTCTCTC


Protein sequences

Name Description Sequence
Ptp.713 translated coding region predicted by ESTScan from UniGene Ptp.713

ERSYVPTRVMGTFGYVAPEYACTGMLNEKSDVYSFGILIMEIISGRSPVDYSRPQGEVNLVEWLKTMVGNRKSEEVVDPKLPEMPASKALKRALLVALKCVDPDATKRPKMGHVIHMLEADDLLFRDERRVGREPSHSQHDYEQENHAAMKFIDKQSGEGTSDTSEGESGRKHHQPTRWR

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR24420:SF688
1-180 SUBFAMILY NOT NAMED

ERSYVPTRVMGTFGYVAPEYACTGMLNEKSDVYSFGILIMEIISGRSPVDYSRPQGEVNLVEWLKTMVGNRKSEEVVDPKLPEMPASKALKRALLVALKCVDPDATKRPKMGHVIHMLEADDLLFRDERRVGREPSHSQHDYEQENHAAMKFIDKQSGEGTSDTSEGESGRKHHQPTRWR

ProfileScan: PS50011
IPR000719
1-124 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

ERSYVPTRVMGTFGYVAPEYACTGMLNEKSDVYSFGILIMEIISGRSPVDYSRPQGEVNLVEWLKTMVGNRKSEEVVDPKLPEMPASKALKRALLVALKCVDPDATKRPKMGHVIHMLEADDLL

HMMPanther: PTHR24420
1-180 FAMILY NOT NAMED,FAMILY NOT NAMED

ERSYVPTRVMGTFGYVAPEYACTGMLNEKSDVYSFGILIMEIISGRSPVDYSRPQGEVNLVEWLKTMVGNRKSEEVVDPKLPEMPASKALKRALLVALKCVDPDATKRPKMGHVIHMLEADDLLFRDERRVGREPSHSQHDYEQENHAAMKFIDKQSGEGTSDTSEGESGRKHHQPTRWR

superfamily: SSF56112
IPR011009
4-126 Protein kinase-like (PK-like)
Protein kinase-like domain

YVPTRVMGTFGYVAPEYACTGMLNEKSDVYSFGILIMEIISGRSPVDYSRPQGEVNLVEWLKTMVGNRKSEEVVDPKLPEMPASKALKRALLVALKCVDPDATKRPKMGHVIHMLEADDLLFR

Gene3D: G3DSA:1.10.510.10
5-118 no description

VPTRVMGTFGYVAPEYACTGMLNEKSDVYSFGILIMEIISGRSPVDYSRPQGEVNLVEWLKTMVGNRKSEEVVDPKLPEMPASKALKRALLVALKCVDPDATKRPKMGHVIHML

HMMPfam: PF07714
IPR001245
13-118 Pkinase_Tyr
Serine-threonine/tyrosine-protein kinase catalytic

FGYVAPEYACTGMLNEKSDVYSFGILIMEIISGRSPVDYSRPQGEVNLVEWLKTMVGNRKSEEVVDPKLPEMPASKALKRALLVALKCVDPDATKRPKMGHVIHML

Seg: seg
86-99 seg

ASKALKRALLVALK






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox