PRGDB00075522 (Ptp.1595)

From PRG Wiki
Jump to: navigation, search
Ptp.1595
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 38576317 (CK091992)
Gene Class Unknown
Domain Type LRR
Gene Species Populus tremula x Populus tremuloides

Comment?

G061P26.3pR Populus tension wood cDNA library Populus tremula x Populus tremuloides cDNA clone G061P26 3', mRNA sequence

DNA Sequence

ttttttttttttttttttACAACAAAGAATGAATTTTATAGGATCAGTTGTTTACGTGTACAGGTTGACAGCATAATCCAACTGTGCCGAGTTAAAAAACAATCAGATTGACTTGGTATGGACAACCGACTGAAGTAAAAACAGATAAGACTGAAAATGGACTTGACAATGACAAAGCTTCTAGAAAAATTTCCAAGCCTAGCTAGACGCTGTAAATCTCTAAATATAATAAACCAAGATGTAAACAACTGGTTAAAATCGGCTTCTCAGTAAATGCAGTCTTCCGCTTTTGCACTGGGTATATATACCGTGTTTTGCTCAAGAGGGTGGTGGGGCCAAGAACTGGTTTCCAGACGTCCTAAGGTTCAGCCCAGATTTCAGAAGATTATTTGGAATTTGACCAGTCAGATTATTGTTCTGCAAGAATAGTTCTCGCAGACCCTTGATGTTTCCAAGTGACGAGGGGATCTCACCAGTGAATCGATTGTCTTCCAAATGCAATGTCTCCAGCATCTTTAGTGAACTCAAATCAGGTATTGATCCTGATAAAGTGTTGTTCCCAAGCCAGATGTCAGCCAATGCAGTCAATCTGGCAATACTTGGTGGGAGTGATCCTGAAAGACCCATGCCTGTC


Protein sequences

Name Description Sequence
Ptp.1595 translated coding region predicted by ESTScan from UniGene Ptp.1595

XTGMGLSGSLPPSIARLTALADIWLGNNTLSGSIPDLSSLKMLETLHLEDNRFTGEIPSSLGNIKGLRELFLQNNNLTGQIPNNLLKSGLNLRTSGNQFLAPPPS


Domains

Domain Start-End Description Sequence

HMMPanther: PTHR24420
2-85 FAMILY NOT NAMED,FAMILY NOT NAMED

TGMGLSGSLPPSIARLTALADIWLGNNTLSGSIPDLSSLKMLETLHLEDNRFTGEIPSSLGNIKGLRELFLQNNNLTGQIPNNL

superfamily: SSF52058
2-105 L domain-like,LRR

TGMGLSGSLPPSIARLTALADIWLGNNTLSGSIPDLSSLKMLETLHLEDNRFTGEIPSSLGNIKGLRELFLQNNNLTGQIPNNLLKSGLNLRTSGNQFLAPPPS

Gene3D: G3DSA:3.80.10.10
3-104 no description

GMGLSGSLPPSIARLTALADIWLGNNTLSGSIPDLSSLKMLETLHLEDNRFTGEIPSSLGNIKGLRELFLQNNNLTGQIPNNLLKSGLNLRTSGNQFLAPPP

HMMPfam: PF00560
IPR001611
43-63 LRR_1
Leucine-rich repeat

LETLHLEDNRFTGEIPSSLGN

HMMPfam: PF00560
IPR001611
67-87 LRR_1
Leucine-rich repeat

LRELFLQNNNLTGQIPNNLLK






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox