PRGDB00075523 (Ptp.1764)

From PRG Wiki
Jump to: navigation, search
Ptp.1764
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 18011379 (BI127408)
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Populus tremula x Populus tremuloides

Comment?

G060P14Y Populus cambium cDNA library Populus tremula x Populus tremuloides cDNA, mRNA sequence

DNA Sequence

TCTACAGAGCTGTCCTGCCTGGAGATCTCCACGTGGCAATCAAGGTTTTGGAGAATGCAAGAGACCTTGATCATGATGATGCTGCGGCTCTTTTTGAAGATATTTCCAGACTTAAACACCCCAACCTCCTGCCGCTATGGGGGTACTGCATTGCAGGTAAAGAGAAGCTCGTACTGTACGAGTTCATGTTCAACGGGGATCTCCACCGTTGGCTCCACGAGCTTCCCACACTCAAAACCAACGTAGAGGACTGGAGCACTGACACGTGGGAGAATCAAAACGTCCATGGGTTCCACGTTGCTTCCCCCGAAGAAAAAACTAACTGGCTCACGCGCCACCGAATCGCCGTCGGAGTGGCTCGTGGAGTTGCCTATCTCCACCATGCGGGATCTACTCATGGCCAGCTCGTCGCGTCCAACATCCTCCTCTCCGATTCTCTCGAACCTCGAGTTGCCGATTTTGGACTTAGAAATGTCGGCTCAAAGAACAAGAGTGTCGGTTTGGAAAAACAAGATTGTGGTTTTGAGCTTGACGT


Protein sequences

Name Description Sequence
Ptp.1764 translated coding region predicted by ESTScan from UniGene Ptp.1764

XYRAVLPGDLHVAIKVLENARDLDHDDAAALFEDISRLKHPNLLPLWGYCIAGKEKLVLYEFMFNGDLHRWLHELPTLKTNVEDWSTDTWENQNVHGFHVASPEEKTNWLTRHRIAVGVARGVAYLHHAGSTHGQLVASNILLSDSLEPRVADFGLRNVGSKNKSVGLEKQDCGFELDV

Domains

Domain Start-End Description Sequence

ProfileScan: PS50011
IPR000719
1-179 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

XYRAVLPGDLHVAIKVLENARDLDHDDAAALFEDISRLKHPNLLPLWGYCIAGKEKLVLYEFMFNGDLHRWLHELPTLKTNVEDWSTDTWENQNVHGFHVASPEEKTNWLTRHRIAVGVARGVAYLHHAGSTHGQLVASNILLSDSLEPRVADFGLRNVGSKNKSVGLEKQDCGFELDV

HMMPanther: PTHR24420
2-160 FAMILY NOT NAMED,FAMILY NOT NAMED

YRAVLPGDLHVAIKVLENARDLDHDDAAALFEDISRLKHPNLLPLWGYCIAGKEKLVLYEFMFNGDLHRWLHELPTLKTNVEDWSTDTWENQNVHGFHVASPEEKTNWLTRHRIAVGVARGVAYLHHAGSTHGQLVASNILLSDSLEPRVADFGLRNVG

HMMSmart: SM00219
IPR020635
2-177 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

YRAVLPGDLHVAIKVLENARDLDHDDAAALFEDISRLKHPNLLPLWGYCIAGKEKLVLYEFMFNGDLHRWLHELPTLKTNVEDWSTDTWENQNVHGFHVASPEEKTNWLTRHRIAVGVARGVAYLHHAGSTHGQLVASNILLSDSLEPRVADFGLRNVGSKNKSVGLEKQDCGFEL

Gene3D: G3DSA:3.30.200.20
2-49 no description

YRAVLPGDLHVAIKVLENARDLDHDDAAALFEDISRLKHPNLLPLWGY

HMMPanther: PTHR24420:SF4
2-160 SUBFAMILY NOT NAMED,SUBFAMILY NOT NAMED

YRAVLPGDLHVAIKVLENARDLDHDDAAALFEDISRLKHPNLLPLWGYCIAGKEKLVLYEFMFNGDLHRWLHELPTLKTNVEDWSTDTWENQNVHGFHVASPEEKTNWLTRHRIAVGVARGVAYLHHAGSTHGQLVASNILLSDSLEPRVADFGLRNVG

superfamily: SSF56112
IPR011009
2-156 Protein kinase-like (PK-like)
Protein kinase-like domain

YRAVLPGDLHVAIKVLENARDLDHDDAAALFEDISRLKHPNLLPLWGYCIAGKEKLVLYEFMFNGDLHRWLHELPTLKTNVEDWSTDTWENQNVHGFHVASPEEKTNWLTRHRIAVGVARGVAYLHHAGSTHGQLVASNILLSDSLEPRVADFGL

HMMPfam: PF07714
IPR001245
9-163 Pkinase_Tyr
Serine-threonine/tyrosine-protein kinase catalytic

DLHVAIKVLENARDLDHDDAAALFEDISRLKHPNLLPLWGYCIAGKEKLVLYEFMFNGDLHRWLHELPTLKTNVEDWSTDTWENQNVHGFHVASPEEKTNWLTRHRIAVGVARGVAYLHHAGSTHGQLVASNILLSDSLEPRVADFGLRNVGSKN

Seg: seg
20-31 seg

ARDLDHDDAAAL

Gene3D: G3DSA:1.10.510.10
50-163 no description

CIAGKEKLVLYEFMFNGDLHRWLHELPTLKTNVEDWSTDTWENQNVHGFHVASPEEKTNWLTRHRIAVGVARGVAYLHHAGSTHGQLVASNILLSDSLEPRVADFGLRNVGSKN






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox