PRGDB00075525 (Ptp.2196)

From PRG Wiki
Jump to: navigation, search
Ptp.2196
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 38594692 (CK110367)
Gene Class RLK
Domain Type Ser-Thr Kinase, Receptor-Like Kinase
Gene Species Populus tremula x Populus tremuloides

Comment?

N056B07 Populus bark cDNA library Populus tremula x Populus tremuloides cDNA clone N056B07 5', mRNA sequence

DNA Sequence

GTCCGGGGTCTATCGAGTTTTATTTTTAAGATGCAAAACCTGGTTGGAAGAAAAGAATCCAAATTGCCTTTGGAGTTGCAAGAGGACTTTTGTACTTGCATGAAGAGTGCAGCAATCAGATTATCCATTGTGATATCAAGCCCCAGAATATACTTCTGGATGAATATTACAATGCAAGGATATCTGACTTTGGTTTGGCAAAGCTCTTGTTGCTGGATCAGAGCCAGACCCATACAGCCATCAGAGGGACAAAAGGGTATGTTGCACCTGAATGGTTCAGGAACCTGCCCGTCACTGTGAAGGTGGATGTGTATAGCTATGGTGTACTTCTGCTAGAGATCATTTGTTGCAGAAGAAATGTGGATAGCAAAGCAACCATAGAAGAACAGGCAATTTTAACAGACTGGGCATATGACTGTTATCGTGAAGGGACATTGGATGCCCTCGTTGGATCTGATACCGGAGCCTTAGATGACATAGAAAAGCTAGAGAGGTTTATGATGATTGCTTTCTGGTGTATTCAGGAAGATCCATCTCTCCGACCCACCATGAGGAAAGTTACACAGATGCTTGAAGGAGTAGTTGAAGTGCCTGTTCCACCATGTCCATGCCTTCTTTACGCAGCAAGTTAAATCAGCTTTGTAGCGTTGCCAGCCCTATTATCTTTCTCTTGTAACCTTTTCTTGATTATTGGCTTCTTCACCAGTGTCTTGTCCACCATAAGTTCTTCACTTTAAGATTATTAGTGCTTGTCGTTTCTGTTTTGCCTGCTACTACAAAAGGCAGCTCTGTCATAAGTAACGCTGTATTCGATGCATTAGTT


Protein sequences

Name Description Sequence
Ptp.2196 translated coding region predicted by ESTScan from UniGene Ptp.2196

XPGSIEFYFXDAKPGWKKRIQIAFGVARGLLYLHEECSNQIIHCDIKPQNILLDEYYNARISDFGLAKLLLLDQSQTHTAIRGTKGYVAPEWFRNLPVTVKVDVYSYGVLLLEIICCRRNVDSKATIEEQAILTDWAYDCYREGTLDALVGSDTGALDDIEKLERFMMIAFWCIQEDPSLRPTMRKVTQMLEGVVEVPVPPCPCLLYAAS

Domains

Domain Start-End Description Sequence

ProfileScan: PS50011
IPR000719
1-195 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

XPGSIEFYFXDAKPGWKKRIQIAFGVARGLLYLHEECSNQIIHCDIKPQNILLDEYYNARISDFGLAKLLLLDQSQTHTAIRGTKGYVAPEWFRNLPVTVKVDVYSYGVLLLEIICCRRNVDSKATIEEQAILTDWAYDCYREGTLDALVGSDTGALDDIEKLERFMMIAFWCIQEDPSLRPTMRKVTQMLEGVV

HMMSmart: SM00220
IPR002290
2-191 Serine/Threonine protein kinases, catalytic
Serine/threonine- / dual-specificity protein kinas

PGSIEFYFXDAKPGWKKRIQIAFGVARGLLYLHEECSNQIIHCDIKPQNILLDEYYNARISDFGLAKLLLLDQSQTHTAIRGTKGYVAPEWFRNLPVTVKVDVYSYGVLLLEIICCRRNVDSKATIEEQAILTDWAYDCYREGTLDALVGSDTGALDDIEKLERFMMIAFWCIQEDPSLRPTMRKVTQML

HMMSmart: SM00219
IPR020635
3-191 Tyrosine kinase, catalytic domain
Tyrosine-protein kinase, catalytic domain

GSIEFYFXDAKPGWKKRIQIAFGVARGLLYLHEECSNQIIHCDIKPQNILLDEYYNARISDFGLAKLLLLDQSQTHTAIRGTKGYVAPEWFRNLPVTVKVDVYSYGVLLLEIICCRRNVDSKATIEEQAILTDWAYDCYREGTLDALVGSDTGALDDIEKLERFMMIAFWCIQEDPSLRPTMRKVTQML

superfamily: SSF56112
IPR011009
3-191 Protein kinase-like (PK-like)
Protein kinase-like domain

GSIEFYFXDAKPGWKKRIQIAFGVARGLLYLHEECSNQIIHCDIKPQNILLDEYYNARISDFGLAKLLLLDQSQTHTAIRGTKGYVAPEWFRNLPVTVKVDVYSYGVLLLEIICCRRNVDSKATIEEQAILTDWAYDCYREGTLDALVGSDTGALDDIEKLERFMMIAFWCIQEDPSLRPTMRKVTQML

HMMPanther: PTHR24420
13-203 FAMILY NOT NAMED,FAMILY NOT NAMED

KPGWKKRIQIAFGVARGLLYLHEECSNQIIHCDIKPQNILLDEYYNARISDFGLAKLLLLDQSQTHTAIRGTKGYVAPEWFRNLPVTVKVDVYSYGVLLLEIICCRRNVDSKATIEEQAILTDWAYDCYREGTLDALVGSDTGALDDIEKLERFMMIAFWCIQEDPSLRPTMRKVTQMLEGVVEVPVPPCP

HMMPanther: PTHR24420:SF815
13-203 RLK1 (RECEPTOR-LIKE PROTEIN KINASE 1); CARBOHYDRATE BINDING / KINASE

KPGWKKRIQIAFGVARGLLYLHEECSNQIIHCDIKPQNILLDEYYNARISDFGLAKLLLLDQSQTHTAIRGTKGYVAPEWFRNLPVTVKVDVYSYGVLLLEIICCRRNVDSKATIEEQAILTDWAYDCYREGTLDALVGSDTGALDDIEKLERFMMIAFWCIQEDPSLRPTMRKVTQMLEGVVEVPVPPCP

Gene3D: G3DSA:1.10.510.10
15-192 no description

GWKKRIQIAFGVARGLLYLHEECSNQIIHCDIKPQNILLDEYYNARISDFGLAKLLLLDQSQTHTAIRGTKGYVAPEWFRNLPVTVKVDVYSYGVLLLEIICCRRNVDSKATIEEQAILTDWAYDCYREGTLDALVGSDTGALDDIEKLERFMMIAFWCIQEDPSLRPTMRKVTQMLE

HMMPfam: PF00069
IPR000719
17-189 Pkinase,Ser-thr
Protein kinase, catalytic domain

KKRIQIAFGVARGLLYLHEECSNQIIHCDIKPQNILLDEYYNARISDFGLAKLLLLDQSQTHTAIRGTKGYVAPEWFRNLPVTVKVDVYSYGVLLLEIICCRRNVDSKATIEEQAILTDWAYDCYREGTLDALVGSDTGALDDIEKLERFMMIAFWCIQEDPSLRPTMRKVTQ

PatternScan: PS00108
IPR008271
41-53 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

IIHCDIKPQNILL

Seg: seg
194-204 seg

VVEVPVPPCPC






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox