PRGDB00075528 (Ptp.2473)

From PRG Wiki
Jump to: navigation, search
Ptp.2473
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 38577488 (CK093163)
Gene Class Unknown
Domain Type Ser-Thr Kinase
Gene Species Populus tremula x Populus tremuloides

Comment?

G110P35.3pR Populus tension wood cDNA library Populus tremula x Populus tremuloides cDNA clone G110P35 3', mRNA sequence

DNA Sequence

ttttttttttttttttttttttttttttagaaaaagaaaaaaCCAGTAAAATTAATTTATATCAACATTCAACTGCAGGCTTTTGTGCAATAGCCCCATCAACAGTAACAATGTGGTCACCACTACCAACACTAACTATACTTCCCGGCAGTTTCCTCTTGGGCTTGGCTTCTTGCAGCATCAACACGACATCCCTCATCGACGGTCGGTCCGCCGGATTCCGGCTGGTGCATAGCAAAGCAATTCTAAGCATTTGCATCATTTCTTCCCTCACATATGCAATCGATGCCCCAGCATCCTTGTCTAAAATGTCATTTACACCGTCCTTAGCCTTTATCTTCGACCTTACCCAGTCAACAATGCTATTACCATCCCCGAACTCAGAATCGACCGACCTCTTGCCGCTTATAATCTCCATTAACACCACCCCATAACTATAAATATCACTCTTCTCATCAACCTGCAGTGTGTAAGCATACTCTGGCGCAATGTAGCCATAAGACCCAGCAATGACTGACATGGATTCGTCACTTTGGATCAGCTTTGCCACCCCAAAATCTGCCACTCTAGCCTCATCTACCGTCCATAATATATTACTAGGCTTAGATCTCGGGCACAATCACAGGATCACATCATGATGCAATAGCAATCCCTGTGCACTCCAGTGCAATCTTGTACTGGTAGCATACCACCAATGCTCCTTGTTTTC


Protein sequences

Name Description Sequence
Ptp.2473 translated coding region predicted by ESTScan from UniGene Ptp.2473

ENKEHWWYATSTRLHWSAQGLLLHHDVILXLCPRSKPSNILWTVDEARVADFGVAKLIQSDESMSVIAGSYGYIAPEYAYTLQVDEKSDIYSYGVVLMEIISGKRSVDSEFGDGNSIVDWVRSKIKAKDGVNDILDKDAGASIAYVREEMMQMLRIALLCTSRNPADRPSMRDVVLMLQEAKPKRKLPGSIVSVGSGDHIVTVDGAIAQKPAVEC

Domains

Domain Start-End Description Sequence

ProfileScan: PS50011
IPR000719
1-182 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

ENKEHWWYATSTRLHWSAQGLLLHHDVILXLCPRSKPSNILWTVDEARVADFGVAKLIQSDESMSVIAGSYGYIAPEYAYTLQVDEKSDIYSYGVVLMEIISGKRSVDSEFGDGNSIVDWVRSKIKAKDGVNDILDKDAGASIAYVREEMMQMLRIALLCTSRNPADRPSMRDVVLMLQEAK

Gene3D: G3DSA:1.10.510.10
23-182 no description

LHHDVILXLCPRSKPSNILWTVDEARVADFGVAKLIQSDESMSVIAGSYGYIAPEYAYTLQVDEKSDIYSYGVVLMEIISGKRSVDSEFGDGNSIVDWVRSKIKAKDGVNDILDKDAGASIAYVREEMMQMLRIALLCTSRNPADRPSMRDVVLMLQEAK

HMMPanther: PTHR24420:SF883
36-188 SUBFAMILY NOT NAMED

KPSNILWTVDEARVADFGVAKLIQSDESMSVIAGSYGYIAPEYAYTLQVDEKSDIYSYGVVLMEIISGKRSVDSEFGDGNSIVDWVRSKIKAKDGVNDILDKDAGASIAYVREEMMQMLRIALLCTSRNPADRPSMRDVVLMLQEAKPKRKLP

superfamily: SSF56112
IPR011009
36-209 Protein kinase-like (PK-like)
Protein kinase-like domain

KPSNILWTVDEARVADFGVAKLIQSDESMSVIAGSYGYIAPEYAYTLQVDEKSDIYSYGVVLMEIISGKRSVDSEFGDGNSIVDWVRSKIKAKDGVNDILDKDAGASIAYVREEMMQMLRIALLCTSRNPADRPSMRDVVLMLQEAKPKRKLPGSIVSVGSGDHIVTVDGAIAQ

HMMPanther: PTHR24420
36-188 FAMILY NOT NAMED,FAMILY NOT NAMED

KPSNILWTVDEARVADFGVAKLIQSDESMSVIAGSYGYIAPEYAYTLQVDEKSDIYSYGVVLMEIISGKRSVDSEFGDGNSIVDWVRSKIKAKDGVNDILDKDAGASIAYVREEMMQMLRIALLCTSRNPADRPSMRDVVLMLQEAKPKRKLP

HMMPfam: PF00069
IPR000719
36-174 Pkinase,Ser-thr
Protein kinase, catalytic domain

KPSNILWTVDEARVADFGVAKLIQSDESMSVIAGSYGYIAPEYAYTLQVDEKSDIYSYGVVLMEIISGKRSVDSEFGDGNSIVDWVRSKIKAKDGVNDILDKDAGASIAYVREEMMQMLRIALLCTSRNPADRPSMRDV






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox