PRGDB00075553 (Ptp.5032)

From PRG Wiki
Jump to: navigation, search
Ptp.5032
Gene Type Putative_R-Genes,_predicted_from_NCBI_UniGene
GenBank 18010715 (BI126744)
Gene Class Unknown
Domain Type
Gene Species Populus tremula x Populus tremuloides

Comment?

I079P62P Populus leaf cDNA library Populus tremula x Populus tremuloides cDNA, mRNA sequence

DNA Sequence

GCGATATCAGGTCCTTTCACAACTAAAACCCTTTGAACTTCACTCCGACCTTCTCATCAGAATCACGAACATTGGTTGAATCAAACCTCCAACTTTTCACGATATGTCTACCAATGGTAACAATCCCGCTCCTTACTTTGAATTATATCGTAGATCGAGTGTCGGTCTTGCTTTGACGGATGCCTTAGACGAGTTGATCCAGAGTGGTCACATCAATCCGCAATTGGCTTTGACCGTCCTGAAGCAGTTTGATAAGTCAGCCTCTCAAGTCTTATCCACCCAACTTCGTTCGAAATGTCAAATCAAAGGACATCTGTCAACTTATCGGCTTTGCGATGAGGTATGGACATTTCTTCTACGTGATTCAATTTTCAAGTTAGAAGGCGGAGAACAAGTCGGTCCAGTGAAACGAGTCAAGATTGTAGCTTGTAAGGGTAATGCCGGGGCATCTGCACCTCCTGCATAATCTTTATTCCATCAGTTGGGCCAAGAGG


Protein sequences

Name Description Sequence
Ptp.5032 translated coding region predicted by ESTScan from UniGene Ptp.5032

XRYQVLSQLKPFELHSDLLIRITNIGXIKPPTFHDMSTNGNNPAPYFELYRRSSVGLALTDALDELIQSGHINPQLALTVLKQFDKSASQVLSTQLRSKCQIKGHLSTYRLCDEVWTFLLRDSIFKLEGGEQVGPVKRVKIVACKGNAGASAPPA

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR10966
IPR003194
45-155 TRANSCRIPTION INITIATION FACTOR IIA SUBUNIT 2
Transcription initiation factor IIA, gamma subunit

PYFELYRRSSVGLALTDALDELIQSGHINPQLALTVLKQFDKSASQVLSTQLRSKCQIKGHLSTYRLCDEVWTFLLRDSIFKLEGGEQVGPVKRVKIVACKGNAGASAPPA

Gene3D: G3DSA:1.10.287.190
IPR015872
45-95 no description
Transcription initiation factor IIA, gamma subunit

PYFELYRRSSVGLALTDALDELIQSGHINPQLALTVLKQFDKSASQVLSTQ

HMMPfam: PF02268
IPR015872
46-92 TFIIA_gamma_N
Transcription initiation factor IIA, gamma subunit

YFELYRRSSVGLALTDALDELIQSGHINPQLALTVLKQFDKSASQVL

BlastProDom: PD009224
IPR015872
47-92 Q4P891_USTMA_Q4P891;
Transcription initiation factor IIA, gamma subunit

FELYRRSSVGLALTDALDELIQSGHINPQLALTVLKQFDKSASQVL

superfamily: SSF47396
IPR009083
47-97 Transcription factor IIA (TFIIA), alpha-helical domain
Transcription factor IIA, helical

FELYRRSSVGLALTDALDELIQSGHINPQLALTVLKQFDKSASQVLSTQLR

superfamily: SSF50784
IPR009088
95-147 Transcription factor IIA (TFIIA), beta-barrel domain
Transcription factor IIA, beta-barrel

QLRSKCQIKGHLSTYRLCDEVWTFLLRDSIFKLEGGEQVGPVKRVKIVACKGN

HMMPfam: PF02751
IPR015871
97-146 TFIIA_gamma_C
Transcription initiation factor IIA, gamma subunit

RSKCQIKGHLSTYRLCDEVWTFLLRDSIFKLEGGEQVGPVKRVKIVACKG

Gene3D: G3DSA:2.30.18.10
IPR009088
98-149 no description
Transcription factor IIA, beta-barrel

SKCQIKGHLSTYRLCDEVWTFLLRDSIFKLEGGEQVGPVKRVKIVACKGNAG






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox